| UniProt ID | ARPC3_YEAST | |
|---|---|---|
| UniProt AC | Q05933 | |
| Protein Name | Actin-related protein 2/3 complex subunit 3 | |
| Gene Name | ARC18 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 178 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
| Protein Sequence | MPAYHSTFPVDPNTDRMVGNFALLPLNTKFRGPAYPSNSDYDIIDECLDLFRANSFFKNFEIKSPADRVLIYGILFINDCLAHLKITTSFNEAVKVLTNVALDNFTLPGTPGFPLNNVYQVPVQDHNSMDLLKTYIQQFRQELAMRLLERVYSSTDSKEYPSKFWLAFTRRRFMNKSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MPAYHSTFPVDPNT -CCCCCCCCCCCCCC | 20.74 | 28889911 | |
| 14 | Phosphorylation | TFPVDPNTDRMVGNF CCCCCCCCCCEECEE | 30.30 | 28889911 | |
| 29 | Ubiquitination | ALLPLNTKFRGPAYP EEEECCCCCCCCCCC | 31.80 | 23749301 | |
| 29 | Acetylation | ALLPLNTKFRGPAYP EEEECCCCCCCCCCC | 31.80 | 24489116 | |
| 58 | Acetylation | FRANSFFKNFEIKSP HHHCCHHHCCCCCCH | 59.73 | 24489116 | |
| 63 | Ubiquitination | FFKNFEIKSPADRVL HHHCCCCCCHHHHHH | 43.09 | 23749301 | |
| 63 | Acetylation | FFKNFEIKSPADRVL HHHCCCCCCHHHHHH | 43.09 | 24489116 | |
| 158 | Ubiquitination | VYSSTDSKEYPSKFW HHHCCCCCCCCCHHH | 65.17 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
