dbPTM

YMW4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YMW4_YEAST
UniProt AC	Q04773
Protein Name	Uncharacterized protein YMR074C
Gene Name	YMR074C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	145
Subcellular Localization
Protein Description
Protein Sequence	MDPELQAIREARLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFERKDFSEDLNSFDKQNAKNDDDEDDDDFFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPELQAI -------CCHHHHHH	20.49	22814378
17	Ubiquitination	EARLAQLKNNSGGTN HHHHHHHHCCCCCCC	41.84	23749301
17	Acetylation	EARLAQLKNNSGGTN HHHHHHHHCCCCCCC	41.84	25381059
96	Phosphorylation	ITEAEIVSILNGIAK CCHHHHHHHHHHHHH	27.33	21440633
107	Phosphorylation	GIAKQQNSQNNSKII HHHHHHHCCCCCEEE	29.91	30377154
112	Acetylation	QNSQNNSKIIFERKD HHCCCCCEEEEECCC	41.78	24489116
118	Acetylation	SKIIFERKDFSEDLN CEEEEECCCHHHHHH	56.80	25381059
121	Phosphorylation	IFERKDFSEDLNSFD EEECCCHHHHHHHHH	40.09	22369663
126	Phosphorylation	DFSEDLNSFDKQNAK CHHHHHHHHHHHHCC	41.96	22369663
129	Ubiquitination	EDLNSFDKQNAKNDD HHHHHHHHHHCCCCC	43.36	24961812
129	Acetylation	EDLNSFDKQNAKNDD HHHHHHHHHHCCCCC	43.36	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YMW4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YMW4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YMW4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PYRF_YEAST	URA3	physical	16554755
SLX5_YEAST	SLX5	genetic	27708008
CHO2_YEAST	CHO2	genetic	27708008
DEP1_YEAST	DEP1	genetic	27708008
DHE5_YEAST	GDH3	genetic	27708008
FMT_YEAST	FMT1	genetic	27708008
QOR_YEAST	ZTA1	genetic	27708008
PYC2_YEAST	PYC2	genetic	27708008
STE50_YEAST	STE50	genetic	27708008
YCY0_YEAST	YCR090C	genetic	27708008
UBP6_YEAST	UBP6	genetic	27708008
PALF_YEAST	RIM8	genetic	27708008
PFD3_YEAST	PAC10	genetic	27708008
BUB1_YEAST	BUB1	genetic	27708008
6PGD2_YEAST	GND2	genetic	27708008
TNA1_YEAST	TNA1	genetic	27708008
BGL2_YEAST	BGL2	genetic	27708008
UBA4_YEAST	UBA4	genetic	27708008
STB5_YEAST	STB5	genetic	27708008
YIF5_YEAST	YIL055C	genetic	27708008
MUD2_YEAST	MUD2	genetic	27708008
ARP6_YEAST	ARP6	genetic	27708008
SWI6_YEAST	SWI6	genetic	27708008
PFD6_YEAST	YKE2	genetic	27708008
ARPC3_YEAST	ARC18	genetic	27708008
GAS1_YEAST	GAS1	genetic	27708008
PFD4_YEAST	GIM3	genetic	27708008
DGK1_YEAST	DGK1	genetic	27708008
CIN1_YEAST	CIN1	genetic	27708008
RL21B_YEAST	RPL21B	genetic	27708008
YAR1_YEAST	YAR1	genetic	27708008
TBCC_YEAST	CIN2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YMW4_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-121 AND SER-126, ANDMASS SPECTROMETRY.	18407956 [Abstract]
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-126, AND MASSSPECTROMETRY.	17563356 [Abstract]