| UniProt ID | CAPZB_YEAST | |
|---|---|---|
| UniProt AC | P13517 | |
| Protein Name | F-actin-capping protein subunit beta | |
| Gene Name | CAP2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 287 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, actin patch . Bud . Bud tip . Found at cortical actin spots at the site of bud emergence and at the tips of growing buds and shmoos. | |
| Protein Description | F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.. | |
| Protein Sequence | MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREYLCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAPLRKLEILANDSFDVYRDLYYEGGISSVYLWDLNEEDFNGHDFAGVVLFKKNQSDHSNWDSIHVFEVTTSPSSPDSFNYRVTTTIILHLDKTKTDQNSHMMLSGNLTRQTEKDIAIDMSRPLDVIFTSHVANLGSLIEDIESQMRNLLETVYFEKTRDIFHQTKNAAIASSAEEANKDAQAEVIRGLQSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSDAQFDAA ------CCHHHHHHH | 41.47 | 22814378 | |
| 2 | Phosphorylation | ------MSDAQFDAA ------CCHHHHHHH | 41.47 | 22369663 | |
| 74 | Phosphorylation | RDIDSFRSPWSNTYY CCCHHCCCCCCCCCC | 28.80 | 19779198 | |
| 85 | Phosphorylation | NTYYPELSPKDLQDS CCCCCCCCHHHHCCC | 28.39 | 17330950 | |
| 92 | Phosphorylation | SPKDLQDSPFPSAPL CHHHHCCCCCCCCCH | 18.58 | 24961812 | |
| 96 | Phosphorylation | LQDSPFPSAPLRKLE HCCCCCCCCCHHHHH | 42.78 | 24961812 | |
| 151 | Phosphorylation | VLFKKNQSDHSNWDS EEEECCCCCCCCCCE | 46.84 | 27017623 | |
| 154 | Phosphorylation | KKNQSDHSNWDSIHV ECCCCCCCCCCEEEE | 44.60 | 27017623 | |
| 158 | Phosphorylation | SDHSNWDSIHVFEVT CCCCCCCEEEEEEEE | 13.25 | 27017623 | |
| 179 | Phosphorylation | DSFNYRVTTTIILHL CCCCEEEEEEEEEEE | 14.82 | 25371407 | |
| 180 | Phosphorylation | SFNYRVTTTIILHLD CCCEEEEEEEEEEEE | 17.09 | 25371407 | |
| 181 | Phosphorylation | FNYRVTTTIILHLDK CCEEEEEEEEEEEEC | 9.17 | 25371407 | |
| 191 | Phosphorylation | LHLDKTKTDQNSHMM EEEECCCCCCCCCEE | 48.31 | 27017623 | |
| 195 | Phosphorylation | KTKTDQNSHMMLSGN CCCCCCCCCEEECCC | 13.71 | 21440633 | |
| 200 | Phosphorylation | QNSHMMLSGNLTRQT CCCCEEECCCCCCCC | 14.03 | 21440633 | |
| 204 | Phosphorylation | MMLSGNLTRQTEKDI EEECCCCCCCCHHHH | 25.40 | 27017623 | |
| 207 | Phosphorylation | SGNLTRQTEKDIAID CCCCCCCCHHHHEEC | 41.53 | 21440633 | |
| 252 | Acetylation | LETVYFEKTRDIFHQ HHHHHHHHHHHHHHH | 38.67 | 24489116 | |
| 252 | Ubiquitination | LETVYFEKTRDIFHQ HHHHHHHHHHHHHHH | 38.67 | 24961812 | |
| 267 | Phosphorylation | TKNAAIASSAEEANK HHHHHHHHCHHHHCH | 24.78 | 22369663 | |
| 268 | Phosphorylation | KNAAIASSAEEANKD HHHHHHHCHHHHCHH | 30.58 | 22369663 | |
| 274 | Ubiquitination | SSAEEANKDAQAEVI HCHHHHCHHHHHHHH | 62.58 | 23749301 | |
| 286 | Phosphorylation | EVIRGLQSL------ HHHHHHHCC------ | 40.88 | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAPZB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAPZB_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAPZB_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85; SER-92; SER-267 ANDSER-268, AND MASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-85, AND MASSSPECTROMETRY. | |
