| UniProt ID | OTU2_YEAST | |
|---|---|---|
| UniProt AC | P38747 | |
| Protein Name | OTU domain-containing protein 2 | |
| Gene Name | OTU2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 307 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTGMESGENLENMEDILARHRKENKDLQNKITGMKKQATKSKRKEVNSKCLDLQDKLKTKQENEIRDWKIANNEVFDAEQEDEVTPEKLLEQLSISRDEKEQQNVPVQQQQQGQTKKRRNRQKERLAKRDAAIAKMKEEAALEASKQPDLKKMEQESIDQLCELKKLKQFDIQPDGHCLFASILDQLKLRHDPKKLDQDMDVMKLRWLSCNYVQEHRDDFIPYLFDEETMKMKDIDEYTKEMEHTAQWGGEIEILALSHVFDCPISILMSGRPIQVYNECGKNPELKLVYYKHSYALGEHYNSLHDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTGMESGEN ------CCCCCCCCC | 45.28 | 22369663 | |
| 6 | Phosphorylation | --MTGMESGENLENM --CCCCCCCCCHHCH | 42.38 | 22369663 | |
| 94 | Phosphorylation | EKLLEQLSISRDEKE HHHHHHHCCCCCHHH | 20.43 | 22369663 | |
| 96 | Phosphorylation | LLEQLSISRDEKEQQ HHHHHCCCCCHHHHH | 30.24 | 22369663 | |
| 100 | Ubiquitination | LSISRDEKEQQNVPV HCCCCCHHHHHCCCH | 66.18 | 23749301 | |
| 137 | Acetylation | DAAIAKMKEEAALEA HHHHHHHHHHHHHHH | 52.26 | 24489116 | |
| 233 | Ubiquitination | DEETMKMKDIDEYTK CHHHHCCCCHHHHHH | 46.11 | 23749301 | |
| 292 | Ubiquitination | ELKLVYYKHSYALGE CCEEEEEEHHHHHHH | 14.37 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OTU2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OTU2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OTU2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...