dbPTM

YL053_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL053_YEAST
UniProt AC	Q12026
Protein Name	Putative uncharacterized protein YLR053C
Gene Name	YLR053C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	108
Subcellular Localization
Protein Description
Protein Sequence	MDMLHNKCSDAIKSTSNSNLSNEVDKQKLQYDDLGNTGFSELFEMESQDNNDSIEDFLFFNINLTQEVEFENQRQYEHTKKTKKHNPFYVPSEVVREMVKKHALNGRI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YL053_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL053_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL053_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL053_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS41_YEAST	VPS41	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
YRA2_YEAST	YRA2	genetic	27708008
RTG3_YEAST	RTG3	genetic	27708008
ATG15_YEAST	ATG15	genetic	27708008
SLT2_YEAST	SLT2	genetic	27708008
YHK5_YEAST	YHR045W	genetic	27708008
TAL1_YEAST	TAL1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL053_YEAST

Related Literatures of Post-Translational Modification