| UniProt ID | BL1S4_YEAST | |
|---|---|---|
| UniProt AC | Q06333 | |
| Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit CNL1 | |
| Gene Name | CNL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 122 | |
| Subcellular Localization | Cytoplasm . Punctate pattern. | |
| Protein Description | Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1), a complex that is involved in endosomal cargo sorting.. | |
| Protein Sequence | MQDNSSHSRESASAGDDPLGIDKLTVDYDYLLYKMRDYVQSIQLDTTELCKKQNEVMVNGIIENTIDKNIAKFKELLEKCDTLENHYEMLNQLAIITDTFKERIAEAVNNYNSLKKGASKSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MQDNSSHSRESA ---CCCCCCCCHHHH | 22369663 | ||
| 6 | Phosphorylation | --MQDNSSHSRESAS --CCCCCCCCHHHHC | 22369663 | ||
| 8 | Phosphorylation | MQDNSSHSRESASAG CCCCCCCCHHHHCCC | 22369663 | ||
| 11 | Phosphorylation | NSSHSRESASAGDDP CCCCCHHHHCCCCCC | 22369663 | ||
| 13 | Phosphorylation | SHSRESASAGDDPLG CCCHHHHCCCCCCCC | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S4_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RUXF_YEAST | SMX3 | physical | 10688190 | |
| BLI1_YEAST | BLI1 | physical | 16554755 | |
| ATC1_YEAST | PMR1 | genetic | 16269340 | |
| ICE2_YEAST | ICE2 | genetic | 16269340 | |
| GPI8_YEAST | GPI8 | genetic | 16269340 | |
| PLMT_YEAST | OPI3 | genetic | 16269340 | |
| CHO2_YEAST | CHO2 | genetic | 16269340 | |
| PMA1_YEAST | PMA1 | genetic | 16269340 | |
| HAC1_YEAST | HAC1 | genetic | 16269340 | |
| KXD1_YEAST | KXD1 | physical | 11283351 | |
| ATG17_YEAST | ATG17 | physical | 18719252 | |
| KXD1_YEAST | KXD1 | physical | 18719252 | |
| BPH1_YEAST | BPH1 | genetic | 23891562 | |
| VAB2_YEAST | VAB2 | physical | 23547030 | |
| SNAPN_YEAST | SNN1 | physical | 23547030 | |
| BL1S1_YEAST | BLS1 | physical | 23547030 | |
| BLI1_YEAST | BLI1 | physical | 23547030 | |
| KXD1_YEAST | KXD1 | physical | 23547030 | |
| SWI6_YEAST | SWI6 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| ATC1_YEAST | PMR1 | genetic | 27708008 | |
| HUR1_YEAST | HUR1 | genetic | 27708008 | |
| ATPN_YEAST | ATP20 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
