UniProt ID | BLI1_YEAST | |
---|---|---|
UniProt AC | P35727 | |
Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit BLI1 | |
Gene Name | BLI1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 113 | |
Subcellular Localization | Endosome . | |
Protein Description | Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in endosomal cargo sorting.. | |
Protein Sequence | MGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELDDVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Ubiquitination | LENKFKLKDDVELDD HHHHHCCCCCCCCCH | 53.09 | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BLI1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BLI1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BLI1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
URH1_YEAST | URH1 | physical | 16554755 | |
KXD1_YEAST | KXD1 | physical | 16554755 | |
STE11_YEAST | STE11 | physical | 16554755 | |
BL1S1_YEAST | BLS1 | physical | 16554755 | |
ATG15_YEAST | ATG15 | genetic | 20093466 | |
SNF11_YEAST | SNF11 | genetic | 20093466 | |
TPS2_YEAST | TPS2 | genetic | 20093466 | |
RV167_YEAST | RVS167 | genetic | 20093466 | |
HUR1_YEAST | HUR1 | genetic | 20093466 | |
ATC1_YEAST | PMR1 | genetic | 20093466 | |
RTS3_YEAST | RTS3 | genetic | 20093466 | |
VPS9_YEAST | VPS9 | genetic | 20093466 | |
STF1_YEAST | STF1 | physical | 22875988 | |
MPS2_YEAST | MPS2 | physical | 22875988 | |
VAB2_YEAST | VAB2 | physical | 23547030 | |
SNAPN_YEAST | SNN1 | physical | 23547030 | |
BL1S1_YEAST | BLS1 | physical | 23547030 | |
BL1S4_YEAST | CNL1 | physical | 23547030 | |
KXD1_YEAST | KXD1 | physical | 23547030 | |
ATC1_YEAST | PMR1 | genetic | 27708008 | |
HUR1_YEAST | HUR1 | genetic | 27708008 | |
GYP3_YEAST | MSB3 | physical | 25971802 | |
BL1S4_YEAST | CNL1 | physical | 25971802 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...