dbPTM

FRM2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FRM2_YEAST
UniProt AC	P37261
Protein Name	Fatty acid repression mutant protein 2
Gene Name	FRM2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	193
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Involved in negative regulation of fatty acid metabolism..
Protein Sequence	MSPTGNYLNAITNRRTIYNLKPELPQGVGLDDVKRTVHVILKNTPTAFNSQVNRAVIIVGDTHKRIWDAVASAMPTAEAKKRPESCRDEAYGSVIFFTDEGPTEKLQRDFPALAAAFPTCAAHTTGAVQIQSWTALELLGLGANLQHYNDYVKSALPQDVPIAWTVQSQLVFGVPTALPEEKTFINNVINVYH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSPTGNYLN ------CCCCCCCHH	31.04	28889911
72	Phosphorylation	RIWDAVASAMPTAEA HHHHHHHHHCCCHHH	20.64	27017623
76	Phosphorylation	AVASAMPTAEAKKRP HHHHHCCCHHHHHCC	24.84	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FRM2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FRM2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FRM2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PUB1_YEAST	PUB1	physical	18467557
HBN1_YEAST	HBN1	genetic	19904831
FRM2_YEAST	FRM2	physical	25864423
OCA5_YEAST	OCA5	genetic	27708008
ICS3_YEAST	ICS3	genetic	27708008
ECM25_YEAST	ECM25	genetic	27708008
DBR1_YEAST	DBR1	genetic	27708008
TRK2_YEAST	TRK2	genetic	27708008
GAL2_YEAST	GAL2	genetic	27708008
ATG3_YEAST	ATG3	genetic	27708008
YP257_YEAST	YPL257W	genetic	27708008
ACH1_YEAST	ACH1	genetic	27708008
SEF1_YEAST	SEF1	genetic	27708008
NU170_YEAST	NUP170	genetic	27708008
YBM6_YEAST	YBR016W	genetic	27708008
RIF1_YEAST	RIF1	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
SOK1_YEAST	SOK1	genetic	27708008
RLA4_YEAST	RPP2B	genetic	27708008
ITR1_YEAST	ITR1	genetic	27708008
MEI4_YEAST	MEI4	genetic	27708008
FMP32_YEAST	FMP32	genetic	27708008
CSK2B_YEAST	CKB1	genetic	27708008
AMA1_YEAST	AMA1	genetic	27708008
YAP3_YEAST	YAP3	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
DOG1_YEAST	DOG1	genetic	27708008
PPME1_YEAST	PPE1	genetic	27708008
GVP36_YEAST	GVP36	genetic	27708008
AGE2_YEAST	AGE2	genetic	27708008
JEM1_YEAST	JEM1	genetic	27708008
ASF1_YEAST	ASF1	genetic	27708008
SNA3_YEAST	SNA3	genetic	27708008
YJS1_YEAST	YJL181W	genetic	27708008
PHO90_YEAST	PHO90	genetic	27708008
YJ09_YEAST	YJR039W	genetic	27708008
IME1_YEAST	IME1	genetic	27708008
YKE44_YEAST	YKL044W	genetic	27708008
MSN4_YEAST	MSN4	genetic	27708008
FOLC_YEAST	RMA1	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
FMP46_YEAST	FMP46	genetic	27708008
GLYC_YEAST	SHM2	genetic	27708008
ARP6_YEAST	ARP6	genetic	27708008
FMS1_YEAST	FMS1	genetic	27708008
RNH2A_YEAST	RNH201	genetic	27708008
NOP12_YEAST	NOP12	genetic	27708008
MSA1_YEAST	MSA1	genetic	27708008
YO283_YEAST	YOR283W	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FRM2_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2, AND MASSSPECTROMETRY.	18407956 [Abstract]