dbPTM

YBM6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YBM6_YEAST
UniProt AC	P38216
Protein Name	Uncharacterized protein YBR016W
Gene Name	YBR016W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	128
Subcellular Localization
Protein Description
Protein Sequence	MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCICCTMDMLF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSANDYYGG ------CCCCCCCCC	35.46	22814378
2	Phosphorylation	------MSANDYYGG ------CCCCCCCCC	35.46	28152593
14	Ubiquitination	YGGTAGEKSQYSRPS CCCCCCCCCCCCCCC	41.77	24961812
14	Acetylation	YGGTAGEKSQYSRPS CCCCCCCCCCCCCCC	41.77	24489116
15	Phosphorylation	GGTAGEKSQYSRPSN CCCCCCCCCCCCCCC	30.01	28889911
17	Phosphorylation	TAGEKSQYSRPSNPP CCCCCCCCCCCCCCC	17.46	21440633
18	Phosphorylation	AGEKSQYSRPSNPPP CCCCCCCCCCCCCCC	30.03	21440633
21	Phosphorylation	KSQYSRPSNPPPSSA CCCCCCCCCCCCCHH	61.94	21440633
26	Phosphorylation	RPSNPPPSSAHQNKT CCCCCCCCHHHCCCC	46.03	28889911
27	Phosphorylation	PSNPPPSSAHQNKTQ CCCCCCCHHHCCCCH	35.23	21440633
32	Ubiquitination	PSSAHQNKTQERGYP CCHHHCCCCHHCCCC	45.04	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YBM6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YBM6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YBM6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP43_YEAST	PRP43	physical	18467557
YBM6_YEAST	YBR016W	physical	19345193
DHE2_YEAST	GDH2	genetic	20093466
TMS1_YEAST	TMS1	genetic	20093466
VMA21_YEAST	VMA21	genetic	27708008
DCOR_YEAST	SPE1	genetic	27708008
DIA2_YEAST	DIA2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YBM6_YEAST

Related Literatures of Post-Translational Modification