UniProt ID | HBN1_YEAST | |
---|---|---|
UniProt AC | Q96VH4 | |
Protein Name | Putative nitroreductase HBN1 | |
Gene Name | HBN1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 193 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MSAVATYLKTLTARRTIYALKPELPGEITINDIQSVVQTIIKETPTAFNSQPNRAVILTGETHKKVWDEVTKAIESPAGQKRPASARDEAFGSVIFFTDDKVTEKLKADFPAYAAAFPSFADHTSGAAQINSWVALEAMGLGGHLQHYNGYIKAALPSKIPESWTVQAQLVFGTPAAPPGEKTYIKNDVEIFN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAVATYLK ------CCHHHHHHH | 31.30 | 22814378 | |
2 | Phosphorylation | ------MSAVATYLK ------CCHHHHHHH | 31.30 | 30377154 | |
6 | Phosphorylation | --MSAVATYLKTLTA --CCHHHHHHHHHHH | 23.84 | 28132839 | |
7 | Phosphorylation | -MSAVATYLKTLTAR -CCHHHHHHHHHHHH | 9.10 | 28132839 | |
9 | Acetylation | SAVATYLKTLTARRT CHHHHHHHHHHHHHE | 30.95 | 24489116 | |
10 | Phosphorylation | AVATYLKTLTARRTI HHHHHHHHHHHHHEE | 27.09 | 28132839 | |
98 | Phosphorylation | FGSVIFFTDDKVTEK CCCEEEECCHHHHHH | 32.32 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBN1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBN1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBN1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...