| UniProt ID | HBN1_YEAST | |
|---|---|---|
| UniProt AC | Q96VH4 | |
| Protein Name | Putative nitroreductase HBN1 | |
| Gene Name | HBN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 193 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | ||
| Protein Sequence | MSAVATYLKTLTARRTIYALKPELPGEITINDIQSVVQTIIKETPTAFNSQPNRAVILTGETHKKVWDEVTKAIESPAGQKRPASARDEAFGSVIFFTDDKVTEKLKADFPAYAAAFPSFADHTSGAAQINSWVALEAMGLGGHLQHYNGYIKAALPSKIPESWTVQAQLVFGTPAAPPGEKTYIKNDVEIFN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAVATYLK ------CCHHHHHHH | 31.30 | 22814378 | |
| 2 | Phosphorylation | ------MSAVATYLK ------CCHHHHHHH | 31.30 | 30377154 | |
| 6 | Phosphorylation | --MSAVATYLKTLTA --CCHHHHHHHHHHH | 23.84 | 28132839 | |
| 7 | Phosphorylation | -MSAVATYLKTLTAR -CCHHHHHHHHHHHH | 9.10 | 28132839 | |
| 9 | Acetylation | SAVATYLKTLTARRT CHHHHHHHHHHHHHE | 30.95 | 24489116 | |
| 10 | Phosphorylation | AVATYLKTLTARRTI HHHHHHHHHHHHHEE | 27.09 | 28132839 | |
| 98 | Phosphorylation | FGSVIFFTDDKVTEK CCCEEEECCHHHHHH | 32.32 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HBN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBN1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...