dbPTM

FMP46_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FMP46_YEAST
UniProt AC	P36141
Protein Name	Putative redox protein FMP46, mitochondrial
Gene Name	FMP46
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	133
Subcellular Localization	Mitochondrion .
Protein Description	Putative mitochondrial redox protein which could be involved in the reduction of small toxic molecules..
Protein Sequence	MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQLLKGDVSHRFDVEIANRFPTWDQLQYMRTSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGNEPADIDKYIIQRK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
84	Acetylation	LDSVLKYKHTDPTFG HHHHHHCCCCCCCCC	38.14	24489116
127	Acetylation	NEPADIDKYIIQRK- CCCCCHHHHHHHCC-	38.39	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FMP46_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FMP46_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FMP46_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBP14_YEAST	UBP14	physical	16554755
YFF2_YEAST	YFL052W	genetic	27708008
LSB3_YEAST	LSB3	genetic	27708008
YGZ2_YEAST	YGL242C	genetic	27708008
STF2_YEAST	STF2	genetic	27708008
NAM8_YEAST	NAM8	genetic	27708008
VID28_YEAST	VID28	genetic	27708008
YJ24_YEAST	KCH1	genetic	27708008
BCA2_YEAST	BAT2	genetic	27708008
ERG3_YEAST	ERG3	genetic	27708008
GLRX8_YEAST	GRX8	genetic	27708008
VID22_YEAST	VID22	genetic	27708008
SST2_YEAST	SST2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FMP46_YEAST

Related Literatures of Post-Translational Modification