| UniProt ID | REEP6_HUMAN | |
|---|---|---|
| UniProt AC | Q96HR9 | |
| Protein Name | Receptor expression-enhancing protein 6 | |
| Gene Name | REEP6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 211 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | May play a role in intracellular protein transport from the endoplasmic reticulum to the cell surface (By similarity). Required for correct function and survival of retinal photoreceptors. [PubMed: 27889058] | |
| Protein Sequence | MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARSRAGITPVAVAGPSTPLEADLKPSQTPQPKDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 68 | Phosphorylation | IGFVYPAYASIKAIE HHHHHHHHHHHHHCC | 9.07 | - | |
| 159 | Phosphorylation | DRIMNDLSGRALDAA HHHHHHCCHHHHHHH | 29.15 | 28857561 | |
| 176 | Phosphorylation | ITRNVLQVLARSRAG CCHHHHHHHHHCCCC | 40.75 | 25262027 | |
| 176 (in isoform 2) | Phosphorylation | - | 40.75 | 30278072 | |
| 178 | Phosphorylation | RNVLQVLARSRAGIT HHHHHHHHHCCCCCC | 28.38 | 25849741 | |
| 178 (in isoform 2) | Phosphorylation | - | 28.38 | 25849741 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of REEP6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of REEP6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of REEP6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RS20_HUMAN | RPS20 | physical | 21988832 | |
| SNX1_HUMAN | SNX1 | physical | 21988832 | |
| REEP6_HUMAN | REEP6 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
