YOS1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOS1_YEAST
• UniProt AC: Q3E834
• Protein Name: Protein transport protein YOS1
• Gene Name: YOS1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 85
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Golgi apparatus membrane ; Multi-pass membrane protein .
• Protein Description: Required for protein transport between endoplasmic reticulum and Golgi apparatus..
• Protein Sequence: MVLFGLGRLFYVILLLINAVAVLSEERFLRRIGLGRSNDETPVFGQDQNTTKSKVVQLIGAVQTLLRIPLIGINILVIVYELLLG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	RRIGLGRSNDETPVF HHHCCCCCCCCCCCC	47.00	28889911
41	Phosphorylation	LGRSNDETPVFGQDQ CCCCCCCCCCCCCCC	27.84	23749301
52	Ubiquitination	GQDQNTTKSKVVQLI CCCCCCCHHHHHHHH	46.36	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOS1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOS1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOS1_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YOS1_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.