UniProt ID | AR6P1_HUMAN | |
---|---|---|
UniProt AC | Q15041 | |
Protein Name | ADP-ribosylation factor-like protein 6-interacting protein 1 | |
Gene Name | ARL6IP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 203 | |
Subcellular Localization |
Endomembrane system Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . Endoplasmic reticulum . Predominantly localized to intracytoplasmic membranes. Preferentially localizes at the ER tubules and the edge |
|
Protein Description | Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (By similarity). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. [PubMed: 24262037 Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9 Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself] | |
Protein Sequence | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Ubiquitination | YYLDPSVLSGVSCFV HHHCHHHHHHHHHHH | 4.29 | - | |
85 | Ubiquitination | CLADYLVPILAPRIF HHHHHHHHHHHHHHC | 17.18 | - | |
95 | Ubiquitination | APRIFGSNKWTTEQQ HHHHCCCCCCCHHHH | 44.24 | - | |
96 | Ubiquitination | PRIFGSNKWTTEQQQ HHHCCCCCCCHHHHH | 47.84 | 21906983 | |
96 | Acetylation | PRIFGSNKWTTEQQQ HHHCCCCCCCHHHHH | 47.84 | 25825284 | |
96 | Ubiquitination | PRIFGSNKWTTEQQQ HHHCCCCCCCHHHHH | 47.84 | 21890473 | |
96 | 2-Hydroxyisobutyrylation | PRIFGSNKWTTEQQQ HHHCCCCCCCHHHHH | 47.84 | - | |
96 | Ubiquitination | PRIFGSNKWTTEQQQ HHHCCCCCCCHHHHH | 47.84 | 21890473 | |
114 | Ubiquitination | EICSNLVKTRRRAVG HHHHHHHHHHHHHHH | 39.21 | 21906983 | |
114 | Acetylation | EICSNLVKTRRRAVG HHHHHHHHHHHHHHH | 39.21 | 25953088 | |
114 | Ubiquitination | EICSNLVKTRRRAVG HHHHHHHHHHHHHHH | 39.21 | 21890473 | |
124 | Ubiquitination | RRAVGWWKRLFTLKE HHHHHHHHHHHHCCC | 32.49 | 21906983 | |
124 | Ubiquitination | RRAVGWWKRLFTLKE HHHHHHHHHHHHCCC | 32.49 | 21890473 | |
124 | 2-Hydroxyisobutyrylation | RRAVGWWKRLFTLKE HHHHHHHHHHHHCCC | 32.49 | - | |
130 | 2-Hydroxyisobutyrylation | WKRLFTLKEEKPKMY HHHHHHCCCCCCCHH | 61.85 | - | |
159 | Ubiquitination | GQQVHNLLLTYLIVT HHHHHHHHHHHHHHH | 4.00 | - | |
164 | Ubiquitination | NLLLTYLIVTSLLLL HHHHHHHHHHHHHHC | 1.93 | - | |
188 | 2-Hydroxyisobutyrylation | LKYIGMAKREINKLL HHHHHHHHHHHHHHH | 41.49 | - | |
188 | Ubiquitination | LKYIGMAKREINKLL HHHHHHHHHHHHHHH | 41.49 | - | |
193 | Ubiquitination | MAKREINKLLKQKEK HHHHHHHHHHHHHHH | 61.94 | - | |
193 | Acetylation | MAKREINKLLKQKEK HHHHHHHHHHHHHHH | 61.94 | 27452117 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AR6P1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AR6P1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AR6P1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INP5K_HUMAN | INPP5K | physical | 16189514 | |
FBXW7_HUMAN | FBXW7 | physical | 16169070 | |
FDFT_HUMAN | FDFT1 | physical | 16169070 | |
AR6P1_HUMAN | ARL6IP1 | physical | 25416956 | |
GORS2_HUMAN | GORASP2 | physical | 25416956 | |
WIPI2_HUMAN | WIPI2 | physical | 25416956 | |
SNX10_HUMAN | SNX10 | physical | 25416956 | |
SNX15_HUMAN | SNX15 | physical | 25416956 | |
SNX11_HUMAN | SNX11 | physical | 25416956 | |
SNX12_HUMAN | SNX12 | physical | 25416956 | |
MTEF3_HUMAN | MTERF3 | physical | 25416956 | |
TIM16_HUMAN | PAM16 | physical | 25416956 | |
SPG21_HUMAN | SPG21 | physical | 25416956 | |
DBLOH_HUMAN | DIABLO | physical | 25416956 | |
RTN4_HUMAN | RTN4 | physical | 25416956 | |
SENP2_HUMAN | SENP2 | physical | 25416956 | |
SNAB_HUMAN | NAPB | physical | 25416956 | |
GOLP3_HUMAN | GOLPH3 | physical | 25416956 | |
NDRG4_HUMAN | NDRG4 | physical | 25416956 | |
ZFY21_HUMAN | ZFYVE21 | physical | 25416956 | |
ACSF2_HUMAN | ACSF2 | physical | 25416956 | |
RETR3_HUMAN | FAM134C | physical | 25416956 | |
ZN391_HUMAN | ZNF391 | physical | 25416956 | |
GLP3L_HUMAN | GOLPH3L | physical | 21516116 | |
SNX1_HUMAN | SNX1 | physical | 21516116 | |
ACSF2_HUMAN | ACSF2 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
615685 | Spastic paraplegia 61, autosomal recessive (SPG61) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...