| UniProt ID | YPT32_YEAST | |
|---|---|---|
| UniProt AC | P51996 | |
| Protein Name | GTP-binding protein YPT32/YPT11 | |
| Gene Name | YPT32 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 222 | |
| Subcellular Localization |
Golgi apparatus membrane Lipid-anchor . |
|
| Protein Description | Required for protein transport through the secretory pathway. Probably involved in regulation of secretory vesicle formation at the trans-Golgi compartment. Mediates the proper polarized localization of SEC2, a GEF for SEC4, but does not alter the exchange activity of SEC2 on SEC4. Plays a role in autophagy.. | |
| Protein Sequence | MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSNEDYGYD ------CCCCCCCCC | 49.26 | - | |
| 2 | Phosphorylation | ------MSNEDYGYD ------CCCCCCCCC | 49.26 | 28152593 | |
| 26 | Ubiquitination | IGDSGVGKSNLLSRF ECCCCCCHHHHHHHC | 33.49 | 23749301 | |
| 35 | Phosphorylation | NLLSRFTTDEFNIES HHHHHCCCCCCCCCC | 30.71 | 30377154 | |
| 42 | Phosphorylation | TDEFNIESKSTIGVE CCCCCCCCCCEEEEE | 28.27 | 24961812 | |
| 44 | Phosphorylation | EFNIESKSTIGVEFA CCCCCCCCEEEEEEE | 34.24 | 22369663 | |
| 45 | Phosphorylation | FNIESKSTIGVEFAT CCCCCCCEEEEEEEE | 26.03 | 22369663 | |
| 63 | Ubiquitination | EVENKKIKAQIWDTA EEECCEEEEEEECCC | 43.02 | 23749301 | |
| 80 | Phosphorylation | ERYRAITSAYYRGAV HHHHHHHHHHHHCCC | 14.25 | 27214570 | |
| 127 | Ubiquitination | AVGLIGNKSDLAHLR EEEEECCHHHHHHHC | 39.88 | 24961812 | |
| 186 | Phosphorylation | SKHQVDLSGSGTNNM HHCCCCCCCCCCCCC | 26.84 | 22369663 | |
| 188 | Phosphorylation | HQVDLSGSGTNNMGS CCCCCCCCCCCCCCC | 38.78 | 22369663 | |
| 190 | Phosphorylation | VDLSGSGTNNMGSNG CCCCCCCCCCCCCCC | 25.72 | 22369663 | |
| 195 | Phosphorylation | SGTNNMGSNGAPKGP CCCCCCCCCCCCCCC | 22.71 | 23749301 | |
| 200 | Ubiquitination | MGSNGAPKGPTISLT CCCCCCCCCCEEECC | 76.59 | 23749301 | |
| 203 | Phosphorylation | NGAPKGPTISLTPAP CCCCCCCEEECCCCC | 31.69 | 24961812 | |
| 205 | Phosphorylation | APKGPTISLTPAPKE CCCCCEEECCCCCHH | 28.77 | 27214570 | |
| 207 | Phosphorylation | KGPTISLTPAPKEDK CCCEEECCCCCHHHH | 15.60 | 27214570 | |
| 221 | Geranylgeranylation | KKKKSSNCC------ HCCCCCCCC------ | 2.92 | - | |
| 222 | Geranylgeranylation | KKKSSNCC------- CCCCCCCC------- | 7.96 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPT32_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPT32_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPT32_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
