dbPTM

ERP5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERP5_YEAST
UniProt AC	P38819
Protein Name	Protein ERP5
Gene Name	ERP5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	212
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type I membrane protein.
Protein Description	Involved in vesicular protein trafficking..
Protein Sequence	MKYNIVHGICLLFAITQAVGAVHFYAKSGETKCFYEHLSRGNLLIGDLDLYVEKDGLFEEDPESSLTITVDETFDNDHRVLNQKNSHTGDVTFTALDTGEHRFCFTPFYSKKSATLRVFIELEIGNVEALDSKKKEDMNSLKGRVGQLTQRLSSIRKEQDAIREKEAEFRNQSESANSKIMTWSVFQLLILLGTCAFQLRYLKNFFVKQKVV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
171	N-linked_Glycosylation	EKEAEFRNQSESANS HHHHHHHCCCHHHHH	55.86	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERP5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERP5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERP5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IRE1_YEAST	IRE1	genetic	16269340
SIL1_YEAST	SIL1	genetic	16269340
TLG2_YEAST	TLG2	genetic	16269340
TMEDA_YEAST	ERV25	physical	18467557
HUR1_YEAST	HUR1	genetic	20093466
TFS2_YEAST	DST1	genetic	20093466
RL37A_YEAST	RPL37A	genetic	20093466
ATP10_YEAST	ATP10	genetic	20093466
COX8_YEAST	COX8	genetic	20093466
NGL2_YEAST	NGL2	genetic	20093466
YM96_YEAST	YMR317W	genetic	20093466
PET8_YEAST	PET8	genetic	20093466
ERP2_YEAST	ERP2	physical	16093310
EMP24_YEAST	EMP24	physical	16093310
ERP4_YEAST	ERP4	physical	16093310
PRM9_YEAST	PRM9	physical	16093310
MKAR_YEAST	IFA38	physical	16093310
ELO2_YEAST	ELO2	physical	16093310
GIT1_YEAST	GIT1	physical	16093310
ERV29_YEAST	ERV29	physical	16093310
LAG1_YEAST	LAG1	physical	16093310
YET1_YEAST	YET1	physical	16093310
ELO3_YEAST	ELO3	physical	16093310
GSF2_YEAST	GSF2	physical	16093310
ERP5_YEAST	ERP5	physical	16093310
TMEDA_YEAST	ERV25	physical	22615397
KIN3_YEAST	KIN3	physical	22875988
END3_YEAST	END3	physical	22875988
AF9_YEAST	YAF9	physical	22875988
EMP24_YEAST	EMP24	physical	24217251
TMEDA_YEAST	ERV25	physical	24217251
ERP1_YEAST	ERP1	physical	24217251
ERP3_YEAST	ERP3	physical	24217251
ERP2_YEAST	ERP2	physical	24217251
RRT6_YEAST	RRT6	physical	24217251
HAP3_YEAST	HAP3	genetic	27708008
HUR1_YEAST	HUR1	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
CYT2_YEAST	CYT2	genetic	27708008
ARV1_YEAST	ARV1	genetic	27708008
ATP10_YEAST	ATP10	genetic	27708008
COX8_YEAST	COX8	genetic	27708008
YM96_YEAST	YMR317W	genetic	27708008
CTU2_YEAST	NCS2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERP5_YEAST

Related Literatures of Post-Translational Modification