dbPTM

RRT6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RRT6_YEAST
UniProt AC	P53117
Protein Name	Regulator of rDNA transcription protein 6
Gene Name	RRT6
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	311
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	May be involved in the modulation of rDNA transcription..
Protein Sequence	MEKASLNIAQTKEIPLTDRRMGLRGWKACSRPHLLGRILLFMSILFITSAELSSDVSSREVYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVVFEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNPGNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNTVSDGLFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKSNPSSHIKKKGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
62	Phosphorylation	DVSSREVYMPIFNNK CCCCCCEEEEECCCC	7.75	27214570

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RRT6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RRT6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RRT6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERP3_YEAST	ERP3	physical	24217251
ERP5_YEAST	ERP5	physical	24217251
COPA_YEAST	COP1	physical	24217251
COPB_YEAST	SEC26	physical	24217251
COPB2_YEAST	SEC27	physical	24217251
COPD_YEAST	RET2	physical	24217251
COPE_YEAST	SEC28	physical	24217251
UBL1_YEAST	YUH1	genetic	27708008
TDA1_YEAST	TDA1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
NOP8_YEAST	NOP8	genetic	27708008
MDHP_YEAST	MDH3	genetic	27708008
VPS41_YEAST	VPS41	genetic	27708008
PLP1_YEAST	PLP1	genetic	27708008
RME1_YEAST	RME1	genetic	27708008
YG1X_YEAST	YGR050C	genetic	27708008
INM1_YEAST	INM1	genetic	27708008
BFA1_YEAST	BFA1	genetic	27708008
YJ90_YEAST	YJR120W	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
POM33_YEAST	POM33	genetic	27708008
RL8B_YEAST	RPL8B	genetic	27708008
UBR2_YEAST	UBR2	genetic	27708008
ICT1_YEAST	ICT1	genetic	27708008
EIF3J_YEAST	HCR1	genetic	27708008
SUB1_YEAST	SUB1	genetic	27708008
EAF7_YEAST	EAF7	genetic	27708008
WHI5_YEAST	WHI5	genetic	27708008
HAP5_YEAST	HAP5	genetic	27708008
ALDH6_YEAST	ALD6	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RRT6_YEAST

Related Literatures of Post-Translational Modification