| UniProt ID | KRE1_YEAST | |
|---|---|---|
| UniProt AC | P17260 | |
| Protein Name | Protein KRE1 | |
| Gene Name | KRE1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 313 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. Secreted, cell wall. Identified as GPI-anchored plasma membrane protein (GPI-PMP) as well as component of the cell wall. Concentrated at the surface of mother cells. |
|
| Protein Description | Involved in a late stage of cell wall 1,6-beta-glucan synthesis and assembly. Has a structural, rather than enzymic, function within cell wall 1,6-beta-glucan assembly and architecture, possibly by being involved in covalently cross-linking 1,6-beta-glucans to other cell wall components such as 1,3-beta-glucan, chitin and certain mannoproteins. Acts as the plasma membrane receptor for the yeast K1 viral toxin.. | |
| Protein Sequence | MMRRTLLHSFATLLLSLSLWSAAVMAAVTTQVTVVTNVAGALVTETTIWDPATAAAAATTTAQTGFFTTVFTTTNDVGTTVTLTQTVNRATMLPTTTTSTSSTGKTTTTVPTATSSLSSGLYLSTVTTTNDLGTTVTLTQTFTHSSTSATSSASSSVSSSVSSSGSSSSVKTTTSTGSAVAETGTRPDPSTDFTEPPVSAVTSLSIDSYITITEGTTSTYTTTRAPTSMWVTVVRQGNTITVQTTFVQRFSSQYVTVASPSVGSIGMGTLTGTVGVIKSAIKKTVSHNEAQHLGMSSFTSILGGLLTVLIWFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 288 | GPI-anchor | IKKTVSHNEAQHLGM HHHHCCCCHHHHCCH | 38.50 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRE1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
