| UniProt ID | VPS28_YEAST | |
|---|---|---|
| UniProt AC | Q02767 | |
| Protein Name | Vacuolar protein sorting-associated protein 28 | |
| Gene Name | VPS28 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 242 | |
| Subcellular Localization |
Cytoplasm. Endosome. Late endosome membrane Peripheral membrane protein . |
|
| Protein Description | Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for normal endocytic and biosynthetic traffic to the yeast vacuole.. | |
| Protein Sequence | MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRLERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 59 | Ubiquitination | HVEKAYLKDSIDDTQ HHHHHHHHCCCCCCC | 36.43 | 23749301 | |
| 59 | Acetylation | HVEKAYLKDSIDDTQ HHHHHHHHCCCCCCC | 36.43 | 24489116 | |
| 73 | Acetylation | QYTNTVDKLLKQFKV CCHHHHHHHHHHHHH | 51.92 | 24489116 | |
| 130 | Phosphorylation | AEHAISTTTSAPSGD HHHEEEECCCCCCCC | 16.38 | 27017623 | |
| 131 | Phosphorylation | EHAISTTTSAPSGDN HHEEEECCCCCCCCC | 23.99 | 27017623 | |
| 135 | Phosphorylation | STTTSAPSGDNKQSS EECCCCCCCCCCCCC | 59.50 | 27017623 | |
| 152 | Phosphorylation | DKKFNAKYVAEATGN CHHHCHHHHHHHHCC | 11.50 | 19823750 | |
| 157 | Phosphorylation | AKYVAEATGNFITVM HHHHHHHHCCCCHHH | 24.94 | 19823750 | |
| 162 | Phosphorylation | EATGNFITVMDALKL HHHCCCCHHHHHHHC | 12.97 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS28_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS28_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS28_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
