UniProt ID | SNF8_YEAST | |
---|---|---|
UniProt AC | Q12483 | |
Protein Name | Vacuolar-sorting protein SNF8 | |
Gene Name | SNF8 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 233 | |
Subcellular Localization |
Cytoplasm . Endosome membrane Peripheral membrane protein . |
|
Protein Description | Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.. | |
Protein Sequence | MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
160 | Phosphorylation | RGKKFLRSVPNELTS CCHHHHHCCCCCCCC | 44.04 | 29136822 | |
166 | Phosphorylation | RSVPNELTSDQTKIL HCCCCCCCCCHHHHH | 24.87 | 29136822 | |
167 | Phosphorylation | SVPNELTSDQTKILE CCCCCCCCCHHHHHH | 40.10 | 29136822 | |
170 | Phosphorylation | NELTSDQTKILEICS CCCCCCHHHHHHHHH | 25.66 | 29136822 | |
177 | Phosphorylation | TKILEICSILGYSSI HHHHHHHHHHCCCHH | 26.89 | 29136822 | |
181 | Phosphorylation | EICSILGYSSISLLK HHHHHHCCCHHHHHH | 8.87 | 29136822 | |
182 | Phosphorylation | ICSILGYSSISLLKA HHHHHCCCHHHHHHH | 21.28 | 29136822 | |
183 | Phosphorylation | CSILGYSSISLLKAN HHHHCCCHHHHHHHH | 14.02 | 29136822 | |
185 | Phosphorylation | ILGYSSISLLKANLG HHCCCHHHHHHHHHC | 29.60 | 29136822 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNF8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNF8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNF8_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...