| UniProt ID | TRS33_YEAST | |
|---|---|---|
| UniProt AC | Q99394 | |
| Protein Name | Trafficking protein particle complex subunit 33 | |
| Gene Name | TRS33 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 268 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. Preautophagosomal structure. | |
| Protein Description | Component of the TRAPP I, TRAPP II and TRAPP III complexes which act as guanine nucleotide exchange factors (GEF) for YPT1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation. Required for sporulation. Has a role late in meiosis following DNA replication.. | |
| Protein Sequence | MSSTHSNNVGHPQSSPQGPLTEQQRAQQQYQIFENSLPKVSQSVYQMLLNEMVPLAMGIERQISGDVISSDSNVTSENGNINNMIKRLKIEEHHTVDIIRSHNLIHELYKADEEEKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQIDNLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIPVGIIRGVLSSLGYSSEEVICLASFIDRPTDRPKTAFPKGVSFHVQVTMPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSSTHSNNV ------CCCCCCCCC | 43.90 | 22814378 | |
| 2 | Phosphorylation | ------MSSTHSNNV ------CCCCCCCCC | 43.90 | 22369663 | |
| 3 | Phosphorylation | -----MSSTHSNNVG -----CCCCCCCCCC | 28.92 | 22369663 | |
| 4 | Phosphorylation | ----MSSTHSNNVGH ----CCCCCCCCCCC | 23.24 | 22369663 | |
| 6 | Phosphorylation | --MSSTHSNNVGHPQ --CCCCCCCCCCCCC | 30.13 | 22369663 | |
| 14 | Phosphorylation | NNVGHPQSSPQGPLT CCCCCCCCCCCCCCC | 48.73 | 28132839 | |
| 15 | Phosphorylation | NVGHPQSSPQGPLTE CCCCCCCCCCCCCCH | 18.92 | 22369663 | |
| 21 | Phosphorylation | SSPQGPLTEQQRAQQ CCCCCCCCHHHHHHH | 34.58 | 22369663 | |
| 166 | Acetylation | FICRDVWKQIFGKQI HHHHHHHHHHHCHHH | 33.11 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRS33_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRS33_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRS33_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
