UniProt ID | YO304_YEAST | |
---|---|---|
UniProt AC | O14468 | |
Protein Name | Uncharacterized protein YOR304C-A | |
Gene Name | YOR304C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 76 | |
Subcellular Localization | Cytoplasm . Bud . Bud neck . | |
Protein Description | ||
Protein Sequence | MSTEKLEASEEPQAPLANTSETNSIKGDTENIVTVFDLANEIEKSLKDVQRQMKENDDEFSRSIQAIEDKLNKMSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTEKLEAS ------CCHHHHCCC | 45.32 | 30377154 | |
9 | Phosphorylation | STEKLEASEEPQAPL CHHHHCCCCCCCCCC | 32.87 | 22369663 | |
19 | Phosphorylation | PQAPLANTSETNSIK CCCCCCCCCCCCCCC | 23.49 | 24909858 | |
20 | Phosphorylation | QAPLANTSETNSIKG CCCCCCCCCCCCCCC | 42.08 | 22369663 | |
22 | Phosphorylation | PLANTSETNSIKGDT CCCCCCCCCCCCCCC | 33.75 | 22369663 | |
24 | Phosphorylation | ANTSETNSIKGDTEN CCCCCCCCCCCCCCH | 32.85 | 22369663 | |
29 | Phosphorylation | TNSIKGDTENIVTVF CCCCCCCCCHHEEHH | 39.33 | 22369663 | |
34 | Phosphorylation | GDTENIVTVFDLANE CCCCHHEEHHHHHHH | 16.20 | 22369663 | |
54 | Ubiquitination | KDVQRQMKENDDEFS HHHHHHHHHCCHHHH | 45.06 | 23749301 | |
61 | Phosphorylation | KENDDEFSRSIQAIE HHCCHHHHHHHHHHH | 24.07 | 24961812 | |
63 | Phosphorylation | NDDEFSRSIQAIEDK CCHHHHHHHHHHHHH | 20.18 | 21440633 | |
70 | Acetylation | SIQAIEDKLNKMSR- HHHHHHHHHHHHCC- | 40.96 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO304_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO304_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO304_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...