| UniProt ID | TRS31_YEAST | |
|---|---|---|
| UniProt AC | Q03337 | |
| Protein Name | Trafficking protein particle complex subunit 31 | |
| Gene Name | TRS31 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 283 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. Preautophagosomal structure. | |
| Protein Description | Component of the TRAPP I, TRAPP II and TRAPP III complexes which act as guanine nucleotide exchange factors (GEF) for YPT1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation.. | |
| Protein Sequence | MSQRIIQPSASDQQFPGKSDGYEYTVGPKQAITSEASTTYIPSRIYSESLLFKRQEASLSAMAFLFQEMISQLHRTCKTAGDFETKLSDYGHNIGIRLLELLNFRASVSPSSLPRASAFLSQNESSSKLSNASNSPGMLANSSTATSASANERLQEKQTESLSNYITKMRRRDLKILDILQFIHGTLWSYLFNHVSDDLVKSSERDNEYMIVDNFPTLTQFIPGENVSCEYFVCGIIKGFLFNAGFPCGVTAHRMPQGGHSQRTVYLIQFDRQVLDREGLRFG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | SQRIIQPSASDQQFP CCCCCCCCCCCCCCC | 24.83 | 24961812 | |
| 11 | Phosphorylation | RIIQPSASDQQFPGK CCCCCCCCCCCCCCC | 40.05 | 24961812 | |
| 86 | Acetylation | TAGDFETKLSDYGHN CCCCHHHHHHHHCCH | 38.50 | 24489116 | |
| 109 | Phosphorylation | LNFRASVSPSSLPRA HCCCCCCCHHHCHHH | 19.30 | 21082442 | |
| 111 | Phosphorylation | FRASVSPSSLPRASA CCCCCCHHHCHHHHH | 36.68 | 30377154 | |
| 117 | Phosphorylation | PSSLPRASAFLSQNE HHHCHHHHHHHCCCC | 22.34 | 23749301 | |
| 121 | Phosphorylation | PRASAFLSQNESSSK HHHHHHHCCCCCCHH | 25.22 | 30377154 | |
| 125 | Phosphorylation | AFLSQNESSSKLSNA HHHCCCCCCHHHCCC | 47.68 | 22369663 | |
| 126 | Phosphorylation | FLSQNESSSKLSNAS HHCCCCCCHHHCCCC | 25.88 | 22369663 | |
| 127 | Phosphorylation | LSQNESSSKLSNASN HCCCCCCHHHCCCCC | 47.06 | 22369663 | |
| 135 | Phosphorylation | KLSNASNSPGMLANS HHCCCCCCCCCCCCC | 21.97 | 25752575 | |
| 143 | Phosphorylation | PGMLANSSTATSASA CCCCCCCHHCCCCHH | 23.13 | 19779198 | |
| 144 | Phosphorylation | GMLANSSTATSASAN CCCCCCHHCCCCHHH | 33.50 | 27017623 | |
| 149 | Phosphorylation | SSTATSASANERLQE CHHCCCCHHHHHHHH | 31.24 | 19779198 | |
| 157 | Acetylation | ANERLQEKQTESLSN HHHHHHHHHHHHHHH | 49.94 | 24489116 | |
| 157 | Ubiquitination | ANERLQEKQTESLSN HHHHHHHHHHHHHHH | 49.94 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRS31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRS31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRS31_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-109; SER-125 ANDSER-126, AND MASS SPECTROMETRY. | |
