| UniProt ID | YO08A_YEAST | |
|---|---|---|
| UniProt AC | Q3E7B9 | |
| Protein Name | Uncharacterized protein YOR008C-A | |
| Gene Name | YOR008C-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 74 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | May be involved in the regulation of telomere length.. | |
| Protein Sequence | MWRSYLVFLFFMTPRIQTYCPVPVLRSMAVLNIISPLIIFVSPIKKQDSLHSSACYANLTLVEKLQLWHSMSND | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YO08A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO08A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO08A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO08A_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| RAS2_YEAST | RAS2 | genetic | 27708008 | |
| SHE1_YEAST | SHE1 | genetic | 27708008 | |
| TPS1_YEAST | TPS1 | genetic | 27708008 | |
| SWC5_YEAST | SWC5 | genetic | 27708008 | |
| MGR1_YEAST | MGR1 | genetic | 27708008 | |
| PEX19_YEAST | PEX19 | genetic | 27708008 | |
| SAC3_YEAST | SAC3 | genetic | 27708008 | |
| UME6_YEAST | UME6 | genetic | 27708008 | |
| SWR1_YEAST | SWR1 | genetic | 27708008 | |
| RLA4_YEAST | RPP2B | genetic | 27708008 | |
| SHE9_YEAST | SHE9 | genetic | 27708008 | |
| SGF73_YEAST | SGF73 | genetic | 27708008 | |
| SAP4_YEAST | SAP4 | genetic | 27708008 | |
| DBF2_YEAST | DBF2 | genetic | 27708008 | |
| CHO2_YEAST | CHO2 | genetic | 27708008 | |
| MED20_YEAST | SRB2 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| YJ24_YEAST | KCH1 | genetic | 27708008 | |
| RL14A_YEAST | RPL14A | genetic | 27708008 | |
| IXR1_YEAST | IXR1 | genetic | 27708008 | |
| PEX1_YEAST | PEX1 | genetic | 27708008 | |
| UPS1_YEAST | UPS1 | genetic | 27708008 | |
| YPT6_YEAST | YPT6 | genetic | 27708008 | |
| TSR2_YEAST | TSR2 | genetic | 27708008 | |
| PKR1_YEAST | PKR1 | genetic | 27708008 | |
| MKS1_YEAST | MKS1 | genetic | 27708008 | |
| YO159_YEAST | YOL159C | genetic | 27708008 | |
| HSP7F_YEAST | SSE1 | genetic | 27708008 | |
| CISY3_YEAST | CIT3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...