UniProt ID | YO08A_YEAST | |
---|---|---|
UniProt AC | Q3E7B9 | |
Protein Name | Uncharacterized protein YOR008C-A | |
Gene Name | YOR008C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 74 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | May be involved in the regulation of telomere length.. | |
Protein Sequence | MWRSYLVFLFFMTPRIQTYCPVPVLRSMAVLNIISPLIIFVSPIKKQDSLHSSACYANLTLVEKLQLWHSMSND | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YO08A_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO08A_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO08A_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO08A_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RV167_YEAST | RVS167 | genetic | 27708008 | |
RAS2_YEAST | RAS2 | genetic | 27708008 | |
SHE1_YEAST | SHE1 | genetic | 27708008 | |
TPS1_YEAST | TPS1 | genetic | 27708008 | |
SWC5_YEAST | SWC5 | genetic | 27708008 | |
MGR1_YEAST | MGR1 | genetic | 27708008 | |
PEX19_YEAST | PEX19 | genetic | 27708008 | |
SAC3_YEAST | SAC3 | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
SWR1_YEAST | SWR1 | genetic | 27708008 | |
RLA4_YEAST | RPP2B | genetic | 27708008 | |
SHE9_YEAST | SHE9 | genetic | 27708008 | |
SGF73_YEAST | SGF73 | genetic | 27708008 | |
SAP4_YEAST | SAP4 | genetic | 27708008 | |
DBF2_YEAST | DBF2 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
MED20_YEAST | SRB2 | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
YJ24_YEAST | KCH1 | genetic | 27708008 | |
RL14A_YEAST | RPL14A | genetic | 27708008 | |
IXR1_YEAST | IXR1 | genetic | 27708008 | |
PEX1_YEAST | PEX1 | genetic | 27708008 | |
UPS1_YEAST | UPS1 | genetic | 27708008 | |
YPT6_YEAST | YPT6 | genetic | 27708008 | |
TSR2_YEAST | TSR2 | genetic | 27708008 | |
PKR1_YEAST | PKR1 | genetic | 27708008 | |
MKS1_YEAST | MKS1 | genetic | 27708008 | |
YO159_YEAST | YOL159C | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 | |
CISY3_YEAST | CIT3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...