YO159_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO159_YEAST
• UniProt AC: Q08300
• Protein Name: Uncharacterized protein YOL159C
• Gene Name: YOL159C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 171
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MVPLFGLFCIFSQLYSLCSAYVDITSGYQVFFNLPTNMTNNQICWLFQASYYDIYSDKSGRTLRTGRFEPGDQQSLIYRDTLVELEAITDSYEYSNLDLSTYNGPEPYNSETDYCTDIMDLVMRVYDEEGHYVHPVANNSTNACAHPTPPTLNNLLISNYSDGRNYKESSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YO159_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO159_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO159_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO159_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ENV10_YEAST	ENV10	genetic	27708008
MAL12_YEAST	MAL12	genetic	27708008
LSM7_YEAST	LSM7	genetic	27708008
PP2A4_YEAST	PPG1	genetic	27708008
YP034_YEAST	YPL034W	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.