dbPTM

IPA3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IPA3_YEAST
UniProt AC	P01094
Protein Name	Protease A inhibitor 3
Gene Name	PAI3
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	68
Subcellular Localization
Protein Description	Specific and potent inhibitor for yeast aspartic protease A (yscA). The proteinase acts as a folding template stabilizing the helical conformation in the inhibitor, which results in the potent and specific blockage of the proteolytic activity..
Protein Sequence	MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTDADESEKHNYQEQYNKLKGAGHKKE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNTDQQKV -------CCHHHHHH	12.59	-
14	Phosphorylation	KVSEIFQSSKEKLQG HHHHHHHHHHHHHHC	32.40	22369663
15	Phosphorylation	VSEIFQSSKEKLQGD HHHHHHHHHHHHHCC	33.77	22369663
31	Acetylation	KVVSDAFKKMASQDK HHHHHHHHHHHHCCC	43.28	25381059
35	Phosphorylation	DAFKKMASQDKDGKT HHHHHHHHCCCCCCC	35.10	27214570
59	Acetylation	NYQEQYNKLKGAGHK HHHHHHHHHCCCCCC	46.79	22865919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IPA3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IPA3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IPA3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STE50_YEAST	STE50	genetic	27708008
S2538_YEAST	YDL119C	genetic	27708008
VMA21_YEAST	VMA21	genetic	27708008
NCA3_YEAST	NCA3	genetic	27708008
TKT1_YEAST	TKL1	genetic	27708008
YPQ3_YEAST	RTC2	genetic	27708008
AMN1_YEAST	AMN1	genetic	27708008
MBA1_YEAST	MBA1	genetic	27708008
HAL4_YEAST	SAT4	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
NHP10_YEAST	NHP10	genetic	27708008
PP2C1_YEAST	PTC1	genetic	27708008
PBP4_YEAST	PBP4	genetic	27708008
MRK1_YEAST	MRK1	genetic	27708008
STF1_YEAST	STF1	genetic	27708008
ACL4_YEAST	YDR161W	genetic	27708008
CYPD_YEAST	CPR5	genetic	27708008
YD476_YEAST	YDR476C	genetic	27708008
CEM1_YEAST	CEM1	genetic	27708008
PP2C2_YEAST	PTC2	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
CGR1_YEAST	CGR1	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
CTU1_YEAST	NCS6	genetic	27708008
IMO32_YEAST	IMO32	genetic	27708008
RL24B_YEAST	RPL24B	genetic	27708008
YCH1_YEAST	YCH1	genetic	27708008
6PGD2_YEAST	GND2	genetic	27708008
BGL2_YEAST	BGL2	genetic	27708008
NVJ1_YEAST	NVJ1	genetic	27708008
RPN10_YEAST	RPN10	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
LPLA_YEAST	AIM22	genetic	27708008
VPS35_YEAST	VPS35	genetic	27708008
BFA1_YEAST	BFA1	genetic	27708008
IME1_YEAST	IME1	genetic	27708008
KKQ8_YEAST	KKQ8	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
VPS51_YEAST	VPS51	genetic	27708008
YL326_YEAST	YLR326W	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
FABD_YEAST	MCT1	genetic	27708008
APC11_YEAST	APC11	genetic	29674565
SWR1_YEAST	SWR1	genetic	29674565
KRE28_YEAST	KRE28	genetic	29674565
CTI6_YEAST	CTI6	genetic	29674565
MDM10_YEAST	MDM10	genetic	29674565
VAC14_YEAST	VAC14	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IPA3_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15, AND MASSSPECTROMETRY.	18407956 [Abstract]