dbPTM

YIA6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YIA6_YEAST
UniProt AC	P40556
Protein Name	Mitochondrial nicotinamide adenine dinucleotide transporter 1
Gene Name	YIA6
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	373
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Mitochondrial inner membrane carrier protein involved in the import of NAD(+) into mitochondria by unidirectional transport or by exchange with intramitochondrially generated dAMP and dGMP..
Protein Sequence	MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	KMNSSTESIIGTTLR CCCCCCCCEECCHHH	21.42	27017623
66	Phosphorylation	TESIIGTTLRKKWVP CCCEECCHHHHCEEE	21.25	27017623
369	Phosphorylation	RNRLENISTMVI--- HHHHHHCCCCCC---	23.25	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YIA6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YIA6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YIA6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLX8_YEAST	SLX8	genetic	20093466
FRMSR_YEAST	YKL069W	genetic	20093466
JNM1_YEAST	JNM1	genetic	20093466
ASK10_YEAST	ASK10	genetic	27708008
PAM17_YEAST	PAM17	genetic	27708008
PKR1_YEAST	PKR1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YIA6_YEAST

Related Literatures of Post-Translational Modification