UniProt ID | YIA6_YEAST | |
---|---|---|
UniProt AC | P40556 | |
Protein Name | Mitochondrial nicotinamide adenine dinucleotide transporter 1 | |
Gene Name | YIA6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 373 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Mitochondrial inner membrane carrier protein involved in the import of NAD(+) into mitochondria by unidirectional transport or by exchange with intramitochondrially generated dAMP and dGMP.. | |
Protein Sequence | MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Phosphorylation | KMNSSTESIIGTTLR CCCCCCCCEECCHHH | 21.42 | 27017623 | |
66 | Phosphorylation | TESIIGTTLRKKWVP CCCEECCHHHHCEEE | 21.25 | 27017623 | |
369 | Phosphorylation | RNRLENISTMVI--- HHHHHHCCCCCC--- | 23.25 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIA6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIA6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIA6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLX8_YEAST | SLX8 | genetic | 20093466 | |
FRMSR_YEAST | YKL069W | genetic | 20093466 | |
JNM1_YEAST | JNM1 | genetic | 20093466 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
PAM17_YEAST | PAM17 | genetic | 27708008 | |
PKR1_YEAST | PKR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...