| UniProt ID | DHSD_YEAST | |
|---|---|---|
| UniProt AC | P37298 | |
| Protein Name | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial | |
| Gene Name | SDH4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 181 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
| Protein Description | Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in system II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH3 and SDH4 form the membrane dimer that anchors the catalytic dimer formed by SDH1 and SDH2 to the matrix surface of the mitochondrial inner membrane. Electrons originating from the catalytic dimer enter the membrane dimer for ubiquinone reduction.. | |
| Protein Sequence | MMLPRSMKFMTGRRIFHTATVRAFQSTAKKSLTIPFLPVLPQKPGGVRGTPNDAYVPPPENKLEGSYHWYMEKIFALSVVPLATTAMLTTGPLSTAADSFFSVMLLGYCYMEFNSCITDYISERVYGVWHKYAMYMLGLGSAVSLFGIYKLETENDGVVGLVKSLWDSSEKDNSQKIEAKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Phosphorylation | TGRRIFHTATVRAFQ CCCCHHHHHHHHHHH | 17.18 | 28889911 | |
| 20 | Phosphorylation | RRIFHTATVRAFQST CCHHHHHHHHHHHHC | 16.22 | 28889911 | |
| 31 | Phosphorylation | FQSTAKKSLTIPFLP HHHCCCCCCEECCCC | 30.00 | 27017623 | |
| 50 | Phosphorylation | KPGGVRGTPNDAYVP CCCCCCCCCCCCCCC | 14.35 | 27017623 | |
| 55 | Phosphorylation | RGTPNDAYVPPPENK CCCCCCCCCCCCCCC | 19.16 | 27017623 | |
| 132 | Phosphorylation | VYGVWHKYAMYMLGL HHHHHHHHHHHHHCC | 5.45 | 27017623 | |
| 135 | Phosphorylation | VWHKYAMYMLGLGSA HHHHHHHHHHCCCHH | 4.88 | 27017623 | |
| 141 | Phosphorylation | MYMLGLGSAVSLFGI HHHHCCCHHHHHHCE | 30.46 | 27017623 | |
| 144 | Phosphorylation | LGLGSAVSLFGIYKL HCCCHHHHHHCEEEE | 20.07 | 27017623 | |
| 149 | Phosphorylation | AVSLFGIYKLETEND HHHHHCEEEEEECCC | 15.20 | 27017623 | |
| 171 | Acetylation | SLWDSSEKDNSQKIE HHHCCCCCCCHHHCC | 65.25 | 24489116 | |
| 176 | Acetylation | SEKDNSQKIEAKK-- CCCCCHHHCCCCC-- | 42.19 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHSD_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHSD_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHSD_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
