UniProt ID | ACBP_YEAST | |
---|---|---|
UniProt AC | P31787 | |
Protein Name | Acyl-CoA-binding protein | |
Gene Name | ACB1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 87 | |
Subcellular Localization | ||
Protein Description | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.. | |
Protein Sequence | MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | QLFEEKAKAVNELPT HHHHHHHHHHHHCCC | 65.03 | 24961812 | |
18 | Phosphorylation | KAVNELPTKPSTDEL HHHHHCCCCCCHHHH | 69.11 | 21440633 | |
19 | Ubiquitination | AVNELPTKPSTDELL HHHHCCCCCCHHHHH | 34.72 | 23749301 | |
19 | Acetylation | AVNELPTKPSTDELL HHHHCCCCCCHHHHH | 34.72 | 24489116 | |
19 | Succinylation | AVNELPTKPSTDELL HHHHCCCCCCHHHHH | 34.72 | 23954790 | |
42 | Acetylation | ATVGDNDKEKPGIFN CCCCCCCCCCCCCCC | 74.10 | 24489116 | |
44 | Acetylation | VGDNDKEKPGIFNMK CCCCCCCCCCCCCCH | 55.04 | 24489116 | |
51 | Ubiquitination | KPGIFNMKDRYKWEA CCCCCCCHHHHHHHH | 39.91 | 24961812 | |
51 | Acetylation | KPGIFNMKDRYKWEA CCCCCCCHHHHHHHH | 39.91 | 24489116 | |
51 | Succinylation | KPGIFNMKDRYKWEA CCCCCCCHHHHHHHH | 39.91 | 23954790 | |
55 | Acetylation | FNMKDRYKWEAWENL CCCHHHHHHHHHHHC | 39.18 | 24489116 | |
55 | 2-Hydroxyisobutyrylation | FNMKDRYKWEAWENL CCCHHHHHHHHHHHC | 39.18 | - | |
63 | Succinylation | WEAWENLKGKSQEDA HHHHHHCCCCCHHHH | 75.72 | 23954790 | |
72 | Ubiquitination | KSQEDAEKEYIALVD CCHHHHHHHHHHHHH | 58.50 | 23749301 | |
72 | Acetylation | KSQEDAEKEYIALVD CCHHHHHHHHHHHHH | 58.50 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACBP_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACBP_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACBP_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...