| UniProt ID | MIC19_YEAST | |
|---|---|---|
| UniProt AC | P43594 | |
| Protein Name | MICOS complex subunit MIC19 | |
| Gene Name | MIC19 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 170 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Enriched at crista junctions. |
|
| Protein Description | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.. | |
| Protein Sequence | MGSNTSKVGAGAEKQQVYTPLTQIDFSQSLVSQLDSSKESDYVTKQNAEKFIEKKVSQRLSNLEVETLKKFEDTLNNSLLSDDDKDAVDGISSSSLNNQIESLNKKLTLFDQLELQKLEKYGGAKGKSDKKTDNGSISIKAKLTECLLANKGKPLNCYEEMEEFKKLVMG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 74 | Phosphorylation | TLKKFEDTLNNSLLS HHHHHHHHHHHCCCC | 20377248 | ||
| 78 | Phosphorylation | FEDTLNNSLLSDDDK HHHHHHHCCCCCCCC | 24961812 | ||
| 81 | Phosphorylation | TLNNSLLSDDDKDAV HHHHCCCCCCCCCCC | 22369663 | ||
| 92 | Phosphorylation | KDAVDGISSSSLNNQ CCCCCCCCHHHHHHH | 21440633 | ||
| 93 | Phosphorylation | DAVDGISSSSLNNQI CCCCCCCHHHHHHHH | 27017623 | ||
| 120 | Acetylation | LELQKLEKYGGAKGK HHHHHHHHHCCCCCC | 24489116 | ||
| 132 | Phosphorylation | KGKSDKKTDNGSISI CCCCCCCCCCCCEEE | 27017623 | ||
| 138 | Phosphorylation | KTDNGSISIKAKLTE CCCCCCEEEHHHHHH | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIC19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIC19_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIC19_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
