dbPTM

YO029_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YO029_YEAST
UniProt AC	Q08187
Protein Name	Uncharacterized protein YOL029C
Gene Name	YOL029C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	201
Subcellular Localization
Protein Description
Protein Sequence	MKPVTCCNQKNNIMPSLVPVCCSEKKIESDAKKSISKCCGDKEIYDSENRPITKEDGSWIPGSCKQCRSDPHSRNFCQSLSNKCSSSSFSSNSALSPDLNEQQTDVNYNSIKLPEICSCKNAQMNAASDAKRYLPISYTYQKIRQHMQKNKSIQEQLNPEDSTSISSALENIASGLHVRGQKVELQSIKDALHKMDKNVLE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
23	Phosphorylation	SLVPVCCSEKKIESD HHHHHHCCCCCCCHH	47.53	24961812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YO029_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YO029_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YO029_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RLA1_YEAST	RPP1A	genetic	27708008
CGR1_YEAST	CGR1	genetic	27708008
VPS73_YEAST	VPS73	genetic	27708008
ELM1_YEAST	ELM1	genetic	27708008
ADY4_YEAST	ADY4	genetic	27708008
RAD14_YEAST	RAD14	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
RL19A_YEAST	RPL19B	genetic	27708008
RL19B_YEAST	RPL19B	genetic	27708008
URA7_YEAST	URA7	genetic	27708008
AGP1_YEAST	AGP1	genetic	27708008
SOK1_YEAST	SOK1	genetic	27708008
NBP2_YEAST	NBP2	genetic	27708008
YDR22_YEAST	YDR222W	genetic	27708008
ALDH5_YEAST	ALD5	genetic	27708008
RL24A_YEAST	RPL24A	genetic	27708008
GEP7_YEAST	GEP7	genetic	27708008
MON1_YEAST	MON1	genetic	27708008
MTHR2_YEAST	MET13	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
AIM14_YEAST	AIM14	genetic	27708008
GCN1_YEAST	GCN1	genetic	27708008
DSD1_YEAST	DSD1	genetic	27708008
YGZE_YEAST	YGL260W	genetic	27708008
RL11B_YEAST	RPL11B	genetic	27708008
SYF2_YEAST	SYF2	genetic	27708008
TOM71_YEAST	TOM71	genetic	27708008
YJE3_YEAST	YJL043W	genetic	27708008
RL14A_YEAST	RPL14A	genetic	27708008
MDM35_YEAST	MDM35	genetic	27708008
DBP7_YEAST	DBP7	genetic	27708008
BPT1_YEAST	BPT1	genetic	27708008
RSSA2_YEAST	RPS0B	genetic	27708008
ACE2_YEAST	ACE2	genetic	27708008
MDL1_YEAST	MDL1	genetic	27708008
PFD6_YEAST	YKE2	genetic	27708008
RS30A_YEAST	RPS30A	genetic	27708008
RS30B_YEAST	RPS30A	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
VPS38_YEAST	VPS38	genetic	27708008
RL6B_YEAST	RPL6B	genetic	27708008
OCA1_YEAST	OCA1	genetic	27708008
AAD16_YEAST	YPL088W	genetic	27708008
BECN1_YEAST	VPS30	genetic	27708008
FUMH_YEAST	FUM1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YO029_YEAST

Related Literatures of Post-Translational Modification