UniProt ID | YJE3_YEAST | |
---|---|---|
UniProt AC | P47053 | |
Protein Name | Uncharacterized protein YJL043W | |
Gene Name | YJL043W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 257 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MFVDYSGLERYTDINASFGKLVNTYCCFQRCEAISEQLEILKSLVPKCHDIVALTDEDFASGRTAGLTQKLFAMAMTLHQITDCIDLLQKCNTIIPIEIANPASFESGAATAPLRQSYARLLDDWSHYMGPSTVKHTGCTNRPKWRFPWQQSRTIIIPMLFIGETAMSTRDLRSVLHDCEIRHASEMPLQLLWTSSPELVYATPHVDDYDIWSRYGSDYNMQIEDEDEASKGRQRKCVVQLEALLGALPTTDPLFQW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJE3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJE3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJE3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADY3_YEAST | ADY3 | genetic | 24390141 | |
FAL1_YEAST | FAL1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
AIM4_YEAST | AIM4 | genetic | 27708008 | |
SGF29_YEAST | SGF29 | genetic | 27708008 | |
RNQ1_YEAST | RNQ1 | genetic | 27708008 | |
PP2C1_YEAST | PTC1 | genetic | 27708008 | |
HIM1_YEAST | HIM1 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
RL8A_YEAST | RPL8A | genetic | 27708008 | |
KAPC_YEAST | TPK3 | genetic | 27708008 | |
RL6B_YEAST | RPL6B | genetic | 27708008 | |
RS3A2_YEAST | RPS1B | genetic | 27708008 | |
RAD14_YEAST | RAD14 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
NCBP2_YEAST | CBC2 | genetic | 27708008 | |
NEW1_YEAST | NEW1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...