| UniProt ID | YJE3_YEAST | |
|---|---|---|
| UniProt AC | P47053 | |
| Protein Name | Uncharacterized protein YJL043W | |
| Gene Name | YJL043W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 257 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MFVDYSGLERYTDINASFGKLVNTYCCFQRCEAISEQLEILKSLVPKCHDIVALTDEDFASGRTAGLTQKLFAMAMTLHQITDCIDLLQKCNTIIPIEIANPASFESGAATAPLRQSYARLLDDWSHYMGPSTVKHTGCTNRPKWRFPWQQSRTIIIPMLFIGETAMSTRDLRSVLHDCEIRHASEMPLQLLWTSSPELVYATPHVDDYDIWSRYGSDYNMQIEDEDEASKGRQRKCVVQLEALLGALPTTDPLFQW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJE3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJE3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJE3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ADY3_YEAST | ADY3 | genetic | 24390141 | |
| FAL1_YEAST | FAL1 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| PRP19_YEAST | PRP19 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| AIM4_YEAST | AIM4 | genetic | 27708008 | |
| SGF29_YEAST | SGF29 | genetic | 27708008 | |
| RNQ1_YEAST | RNQ1 | genetic | 27708008 | |
| PP2C1_YEAST | PTC1 | genetic | 27708008 | |
| HIM1_YEAST | HIM1 | genetic | 27708008 | |
| CHO2_YEAST | CHO2 | genetic | 27708008 | |
| RL8A_YEAST | RPL8A | genetic | 27708008 | |
| KAPC_YEAST | TPK3 | genetic | 27708008 | |
| RL6B_YEAST | RPL6B | genetic | 27708008 | |
| RS3A2_YEAST | RPS1B | genetic | 27708008 | |
| RAD14_YEAST | RAD14 | genetic | 27708008 | |
| SCS7_YEAST | SCS7 | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| NCBP2_YEAST | CBC2 | genetic | 27708008 | |
| NEW1_YEAST | NEW1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...