UniProt ID | NKP1_YEAST | |
---|---|---|
UniProt AC | Q12493 | |
Protein Name | Inner kinetochore subunit NKP1 {ECO:0000305} | |
Gene Name | NKP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 238 | |
Subcellular Localization | Nucleus . Chromosome, centromere, kinetochore . Associated with kinetochores. | |
Protein Description | Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly.. | |
Protein Sequence | MTDTYNSISNFIENELTALLSSDDYLMDDLAGELPNEVCRLLKAQVIEKRKDAMSRGKQDLLSKEIYDNESELRASQSQQIMELVGDIPKYSLGSELRNRVEGEPQSTSIERLIEDVLKLPQMEVADEEEVEVENDLKVLSEYSNLRKDLILKCQALQIGESKLSDILSQTNSINSLTTSIKEASEDDDISEYFATYNGKLVVALEEMKLLLEEAVKTFGNSPEKREKIKKILSELKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Phosphorylation | EKRKDAMSRGKQDLL HHHHHHHHHCCHHHH | 39.33 | 27017623 | |
63 | Phosphorylation | RGKQDLLSKEIYDNE HCCHHHHHHHHCCCH | 35.22 | 27017623 | |
76 | Phosphorylation | NESELRASQSQQIME CHHHHHHHHHHHHHH | 24.75 | 27017623 | |
78 | Phosphorylation | SELRASQSQQIMELV HHHHHHHHHHHHHHH | 22.89 | 27017623 | |
222 | Phosphorylation | AVKTFGNSPEKREKI HHHHHCCCHHHHHHH | 34.51 | 25752575 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NKP1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKP1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKP1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NKP2_YEAST | NKP2 | physical | 20826334 | |
SRS2_YEAST | SRS2 | genetic | 21459050 | |
FABG_YEAST | OAR1 | genetic | 27708008 | |
HFA1_YEAST | HFA1 | genetic | 27708008 | |
SLA1_YEAST | SLA1 | genetic | 27708008 | |
CHK1_YEAST | CHK1 | genetic | 27708008 | |
RL13A_YEAST | RPL13A | genetic | 27708008 | |
VMS1_YEAST | VMS1 | genetic | 27708008 | |
RPA14_YEAST | RPA14 | genetic | 27708008 | |
SCS2_YEAST | SCS2 | genetic | 27708008 | |
SA155_YEAST | SAP155 | genetic | 27708008 | |
PALF_YEAST | RIM8 | genetic | 27708008 | |
GEP7_YEAST | GEP7 | genetic | 27708008 | |
PIL1_YEAST | PIL1 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
TBP7_YEAST | YTA7 | genetic | 27708008 | |
YOR1_YEAST | YOR1 | genetic | 27708008 | |
ATG32_YEAST | ATG32 | genetic | 27708008 | |
RL17B_YEAST | RPL17B | genetic | 27708008 | |
DOHH_YEAST | LIA1 | genetic | 27708008 | |
I23O_YEAST | BNA2 | genetic | 27708008 | |
DBP7_YEAST | DBP7 | genetic | 27708008 | |
BPT1_YEAST | BPT1 | genetic | 27708008 | |
ACE2_YEAST | ACE2 | genetic | 27708008 | |
ADY4_YEAST | ADY4 | genetic | 27708008 | |
PSP2_YEAST | PSP2 | genetic | 27708008 | |
RIM13_YEAST | RIM13 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-222, AND MASSSPECTROMETRY. |