| UniProt ID | TSC3_YEAST | |
|---|---|---|
| UniProt AC | Q3E790 | |
| Protein Name | Serine palmitoyltransferase-regulating protein TSC3 | |
| Gene Name | TSC3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 80 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
| Protein Description | Stimulates the activity of serine palmitoyltransferase (SPT).. | |
| Protein Sequence | MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFFLTIFSLSFFGILKYCFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | QHKSSMVYIPTTKEA CCCCCCEECCCCHHH | 7.79 | 28889911 | |
| 13 | Phosphorylation | SSMVYIPTTKEAKRR CCCEECCCCHHHHHH | 40.73 | 28889911 | |
| 14 | Phosphorylation | SMVYIPTTKEAKRRN CCEECCCCHHHHHHC | 22.87 | 28889911 | |
| 15 | Ubiquitination | MVYIPTTKEAKRRNG CEECCCCHHHHHHCC | 59.14 | 23749301 | |
| 18 | Ubiquitination | IPTTKEAKRRNGKSE CCCCHHHHHHCCCCC | 53.64 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TSC3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TSC3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TSC3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
