| UniProt ID | COAD_YEAST | |
|---|---|---|
| UniProt AC | P53332 | |
| Protein Name | Phosphopantetheine adenylyltransferase | |
| Gene Name | CAB4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 305 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate (By similarity). Plays a role in the physiological regulation of the intracellular CoA concentration.. | |
| Protein Sequence | MVEENSRVLIVLPYTPPSATLQRIIGQTIPFLRECQSQLDIVIVPEFKTSFQLDSALGKMYSITRDVLLGYGMINSGINIIFNNIHFVESNLQWKVVLLPQESTFETWKLELGQGQYHSIEHYALHDNIMEEIEGPKDANKFHVTALGGTFDHIHDGHKILLSVSTFITSQRLICGITCDELLQNKKYKELIEPYDTRCRHVHQFIKLLKPDLSVELVPLRDVCGPTGKVPEIECLVVSRETVSGAETVNKTRIEKGMSPLAVHVVNVLGGREEDGWSEKLSSTEIRRLLKSSASPTCTPQNPCV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 292 | Phosphorylation | EIRRLLKSSASPTCT HHHHHHHHCCCCCCC | 30.98 | 19823750 | |
| 293 | Phosphorylation | IRRLLKSSASPTCTP HHHHHHHCCCCCCCC | 31.04 | 28889911 | |
| 295 | Phosphorylation | RLLKSSASPTCTPQN HHHHHCCCCCCCCCC | 23.77 | 21440633 | |
| 297 | Phosphorylation | LKSSASPTCTPQNPC HHHCCCCCCCCCCCC | 26.90 | 21440633 | |
| 299 | Phosphorylation | SSASPTCTPQNPCV- HCCCCCCCCCCCCC- | 30.32 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COAD_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COAD_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COAD_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
