UniProt ID | TRPF_YEAST | |
---|---|---|
UniProt AC | P00912 | |
Protein Name | N-(5'-phosphoribosyl)anthranilate isomerase | |
Gene Name | TRP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 224 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRKRTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDESWQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDWVGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNAKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVINFTGS ------CCEEECCCC | 31.53 | 22369663 | |
45 | Ubiquitination | IICVPNRKRTIDPVI EEEECCCCCCCCHHH | 61.61 | 22817900 | |
55 | Ubiquitination | IDPVIARKISSLVKA CCHHHHHHHHHHHHH | 37.61 | 22817900 | |
61 | Ubiquitination | RKISSLVKAYKNSSG HHHHHHHHHHHCCCC | 51.82 | 23749301 | |
64 | Ubiquitination | SSLVKAYKNSSGTPK HHHHHHHHCCCCCCC | 56.03 | 23749301 | |
220 | Ubiquitination | NKIANFVKNAKK--- HHHHHHHHHHCC--- | 47.23 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRPF_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRPF_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRPF_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...