| UniProt ID | PAU8_YEAST | |
|---|---|---|
| UniProt AC | P0CE92 | |
| Protein Name | Seripauperin-8 | |
| Gene Name | PAU8 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 120 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC3_YEAST | CDC34 | genetic | 27708008 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| ARP3_YEAST | ARP3 | genetic | 27708008 | |
| RNA1_YEAST | RNA1 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| DED1_YEAST | DED1 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 | |
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| TFB1_YEAST | TFB1 | genetic | 27708008 | |
| SMT3_YEAST | SMT3 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| HSF_YEAST | HSF1 | genetic | 27708008 | |
| MET30_YEAST | MET30 | genetic | 27708008 | |
| CDC6_YEAST | CDC6 | genetic | 27708008 | |
| PRP21_YEAST | PRP21 | genetic | 27708008 | |
| FNTA_YEAST | RAM2 | genetic | 27708008 | |
| MED14_YEAST | RGR1 | genetic | 27708008 | |
| GSP1_YEAST | GSP1 | genetic | 27708008 | |
| CDC25_YEAST | CDC25 | genetic | 27708008 | |
| ERO1_YEAST | ERO1 | genetic | 27708008 | |
| CH10_YEAST | HSP10 | genetic | 27708008 | |
| MED4_YEAST | MED4 | genetic | 27708008 | |
| MOT1_YEAST | MOT1 | genetic | 27708008 | |
| TBF1_YEAST | TBF1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...