UniProt ID | FNTA_YEAST | |
---|---|---|
UniProt AC | P29703 | |
Protein Name | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha | |
Gene Name | RAM2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 316 | |
Subcellular Localization | ||
Protein Description | Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate.. | |
Protein Sequence | MEEYDYSDVKPLPIETDLQDELCRIMYTEDYKRLMGLARALISLNELSPRALQLTAEIIDVAPAFYTIWNYRFNIVRHMMSESEDTVLYLNKELDWLDEVTLNNPKNYQIWSYRQSLLKLHPSPSFKRELPILKLMIDDDSKNYHVWSYRKWCCLFFSDFQHELAYASDLIETDIYNNSAWTHRMFYWVNAKDVISKVELADELQFIMDKIQLVPQNISPWTYLRGFQELFHDRLQWDSKVVDFATTFIGDVLSLPIGSPEDLPEIESSYALEFLAYHWGADPCTRDNAVKAYSLLAIKYDPIRKNLWHHKINNLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FNTA_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FNTA_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FNTA_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FNTA_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RDR1_YEAST | RDR1 | physical | 18719252 | |
MED7_YEAST | MED7 | physical | 18719252 | |
FNTB_YEAST | RAM1 | physical | 18719252 | |
PGTB1_YEAST | CDC43 | physical | 20826334 | |
PGTB1_YEAST | CDC43 | genetic | 23891562 | |
SMI1_YEAST | SMI1 | genetic | 23891562 | |
GUP1_YEAST | GUP1 | genetic | 23891562 | |
CHS5_YEAST | CHS5 | genetic | 23891562 | |
SRO7_YEAST | SRO7 | genetic | 23891562 | |
HMCS_YEAST | ERG13 | genetic | 23891562 | |
THIL_YEAST | ERG10 | genetic | 23891562 | |
CDC24_YEAST | CDC24 | genetic | 23891562 | |
TPM1_YEAST | TPM1 | genetic | 23891562 | |
ICE2_YEAST | ICE2 | genetic | 23891562 | |
PSB1_YEAST | PRE3 | genetic | 23891562 | |
HMDH1_YEAST | HMG1 | genetic | 23891562 | |
CCD33_HUMAN | CCDC33 | physical | 27107014 | |
GAK_HUMAN | GAK | physical | 27107014 | |
SPERT_HUMAN | SPERT | physical | 27107014 | |
TNIP1_HUMAN | TNIP1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...