| UniProt ID | SPERT_HUMAN | |
|---|---|---|
| UniProt AC | Q8NA61 | |
| Protein Name | Spermatid-associated protein | |
| Gene Name | SPERT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 448 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSPLECSECFGDQLLHRTYTWQLTLHSRPNYTRKRDTRSESLEIPISVVLPQRGTAEPFPRLHNLYSTPRCAQQAALPRLSRRMASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHKRLAKECMLQEENKSLREENKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSRFEEPKGPPARQEDSKELRALRKMVSNMSGPSGEEEAKVGPGLPDGCQPLQLLREMRQALQALLKENRLLQEENRTLQVLRAEHRGFQEENKALWENNKLKLQQKLVIDTVTEVTARMEMLIEELYAFMPARSQDPKKPSRV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SPERT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPERT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPERT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPERT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPERT_HUMAN | SPERT | physical | 16189514 | |
| RTP5_HUMAN | RTP5 | physical | 25416956 | |
| CE57L_HUMAN | CEP57L1 | physical | 25416956 | |
| TRI42_HUMAN | TRIM42 | physical | 25416956 | |
| MMAB_HUMAN | MMAB | physical | 25416956 | |
| MLH1_HUMAN | MLH1 | physical | 21516116 | |
| SAPC2_HUMAN | SAPCD2 | physical | 28514442 | |
| RB6I2_HUMAN | ERC1 | physical | 28514442 | |
| KIF11_HUMAN | KIF11 | physical | 28514442 | |
| CSR2B_HUMAN | CSRP2BP | physical | 28514442 | |
| CTNL1_HUMAN | CTNNAL1 | physical | 28514442 | |
| YETS2_HUMAN | YEATS2 | physical | 28514442 | |
| TACC3_HUMAN | TACC3 | physical | 28514442 | |
| ZZZ3_HUMAN | ZZZ3 | physical | 28514442 | |
| MBIP1_HUMAN | MBIP | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
