| UniProt ID | MMAB_HUMAN | |
|---|---|---|
| UniProt AC | Q96EY8 | |
| Protein Name | Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial | |
| Gene Name | MMAB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 250 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Adenosyltransferase involved in intracellular vitamin B12 metabolism. Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer taht is stimulated by ATP-binding to MMAB and gated by MMAA.. | |
| Protein Sequence | MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MAVCGLGSRLGLGSR CCCCCCCCCCCCCCH | 29.40 | 22817900 | |
| 49 | O-linked_Glycosylation | DGDRPQPSSKTPRIP CCCCCCCCCCCCCCC | 38.94 | 23301498 | |
| 49 | Phosphorylation | DGDRPQPSSKTPRIP CCCCCCCCCCCCCCC | 38.94 | 20068231 | |
| 50 | O-linked_Glycosylation | GDRPQPSSKTPRIPK CCCCCCCCCCCCCCE | 47.43 | 23301498 | |
| 50 | Phosphorylation | GDRPQPSSKTPRIPK CCCCCCCCCCCCCCE | 47.43 | 20068231 | |
| 51 | Ubiquitination | DRPQPSSKTPRIPKI CCCCCCCCCCCCCEE | 67.87 | 24816145 | |
| 65 | Acetylation | IYTKTGDKGFSSTFT EEEECCCCCCCCCCC | 64.30 | 25953088 | |
| 88 | Phosphorylation | QVFEAVGTTDELSSA CCHHHCCCHHHHHHH | 25.19 | 28258704 | |
| 89 | Phosphorylation | VFEAVGTTDELSSAI CHHHCCCHHHHHHHH | 22.88 | 28258704 | |
| 93 | Phosphorylation | VGTTDELSSAIGFAL CCCHHHHHHHHHHHH | 18.71 | 28258704 | |
| 133 | Phosphorylation | SALATPCSSAREAHL HHHCCCCCCHHHHHH | 28.38 | 28857561 | |
| 134 | Phosphorylation | ALATPCSSAREAHLK HHCCCCCCHHHHHHH | 37.75 | 28857561 | |
| 144 | Ubiquitination | EAHLKYTTFKAGPIL HHHHHEEEECCCCEE | 21.76 | 24816145 | |
| 145 | Ubiquitination | AHLKYTTFKAGPILE HHHHEEEECCCCEEE | 3.83 | 24816145 | |
| 161 | Phosphorylation | EQWIDKYTSQLPPLT HHHHHHHHHCCCCEE | 18.75 | 27251275 | |
| 162 | Phosphorylation | QWIDKYTSQLPPLTA HHHHHHHHCCCCEEE | 26.99 | 27251275 | |
| 168 | Phosphorylation | TSQLPPLTAFILPSG HHCCCCEEEEEECCC | 25.87 | 27251275 | |
| 202 | Sulfoxidation | RVVPLVQMGETDANV HCEEEEECCCCHHHH | 4.00 | 21406390 | |
| 211 | Acetylation | ETDANVAKFLNRLSD CCHHHHHHHHHHHHH | 46.21 | 23954790 | |
| 211 | Succinylation | ETDANVAKFLNRLSD CCHHHHHHHHHHHHH | 46.21 | - | |
| 211 | Succinylation | ETDANVAKFLNRLSD CCHHHHHHHHHHHHH | 46.21 | - | |
| 217 | Phosphorylation | AKFLNRLSDYLFTLA HHHHHHHHHHHHHHH | 22.44 | 21406692 | |
| 219 | Phosphorylation | FLNRLSDYLFTLARY HHHHHHHHHHHHHHH | 10.59 | 21406692 | |
| 222 | Phosphorylation | RLSDYLFTLARYAAM HHHHHHHHHHHHHHH | 19.53 | 21406692 | |
| 230 | Succinylation | LARYAAMKEGNQEKI HHHHHHHHHCCCCCE | 58.71 | - | |
| 230 | Succinylation | LARYAAMKEGNQEKI HHHHHHHHHCCCCCE | 58.71 | 27452117 | |
| 230 | Acetylation | LARYAAMKEGNQEKI HHHHHHHHHCCCCCE | 58.71 | 25953088 | |
| 236 | Ubiquitination | MKEGNQEKIYMKNDP HHHCCCCCEEECCCC | 29.40 | 24816145 | |
| 244 | Phosphorylation | IYMKNDPSAESEGL- EEECCCCCHHHCCC- | 47.75 | - | |
| 247 | Phosphorylation | KNDPSAESEGL---- CCCCCHHHCCC---- | 36.36 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MMAB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MMAB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MMAB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MMAB_HUMAN !! | ||||
loading...