| UniProt ID | SS120_YEAST | |
|---|---|---|
| UniProt AC | P39931 | |
| Protein Name | Protein SSP120 | |
| Gene Name | SSP120 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 234 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MRFLRGFVFSLAFTLYKVTATAEIGSEINVENEAPPDGLSWEEWHMDHEHQLKDYTPETFFALHDIKKKGFLDENDILSLYGLNREEIVGAGDGMGQHDESEKIDNEMAKRVVSLIMRLLDVDDNTKITKEEYLQFAKRGNKFPDLGVGVGHHSDFELEYEIHHWNKFHKDKDPDVKVVHKEDIEHELLHHEHEIEHEEEIQRGASRATVITDDELESRIELKNIPEKFKNGIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 67 | Acetylation | FFALHDIKKKGFLDE HHHHHHHHHHCCCCH | 55.26 | 24489116 | |
| 103 | Acetylation | GQHDESEKIDNEMAK CCCCHHHHHCHHHHH | 65.72 | 24489116 | |
| 130 | Acetylation | DDNTKITKEEYLQFA CCCCCCCHHHHHHHH | 52.61 | 24489116 | |
| 138 | Acetylation | EEYLQFAKRGNKFPD HHHHHHHHCCCCCCC | 63.23 | 24489116 | |
| 138 | Succinylation | EEYLQFAKRGNKFPD HHHHHHHHCCCCCCC | 63.23 | 23954790 | |
| 212 | Phosphorylation | ASRATVITDDELESR CCCCEEECCHHHHHH | 32.82 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SS120_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SS120_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SS120_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-212, AND MASSSPECTROMETRY. | |