UniProt ID | SS120_YEAST | |
---|---|---|
UniProt AC | P39931 | |
Protein Name | Protein SSP120 | |
Gene Name | SSP120 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 234 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRFLRGFVFSLAFTLYKVTATAEIGSEINVENEAPPDGLSWEEWHMDHEHQLKDYTPETFFALHDIKKKGFLDENDILSLYGLNREEIVGAGDGMGQHDESEKIDNEMAKRVVSLIMRLLDVDDNTKITKEEYLQFAKRGNKFPDLGVGVGHHSDFELEYEIHHWNKFHKDKDPDVKVVHKEDIEHELLHHEHEIEHEEEIQRGASRATVITDDELESRIELKNIPEKFKNGIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Acetylation | FFALHDIKKKGFLDE HHHHHHHHHHCCCCH | 55.26 | 24489116 | |
103 | Acetylation | GQHDESEKIDNEMAK CCCCHHHHHCHHHHH | 65.72 | 24489116 | |
130 | Acetylation | DDNTKITKEEYLQFA CCCCCCCHHHHHHHH | 52.61 | 24489116 | |
138 | Acetylation | EEYLQFAKRGNKFPD HHHHHHHHCCCCCCC | 63.23 | 24489116 | |
138 | Succinylation | EEYLQFAKRGNKFPD HHHHHHHHCCCCCCC | 63.23 | 23954790 | |
212 | Phosphorylation | ASRATVITDDELESR CCCCEEECCHHHHHH | 32.82 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SS120_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SS120_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SS120_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-212, AND MASSSPECTROMETRY. |