| UniProt ID | ATPK_YEAST | |
|---|---|---|
| UniProt AC | Q06405 | |
| Protein Name | ATP synthase subunit f, mitochondrial | |
| Gene Name | ATP17 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 101 | |
| Subcellular Localization | Mitochondrion. Mitochondrion inner membrane. | |
| Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.. | |
| Protein Sequence | MIFKRAVSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Acetylation | PPKVVSSKNIGSAPN CCCCCCCCCCCCCCC | 45.11 | 25381059 | |
| 28 | Succinylation | IGSAPNAKRIANVVH CCCCCCHHHHHHHHH | 51.48 | 23954790 | |
| 38 | Acetylation | ANVVHFYKSLPQGPA HHHHHHHHCCCCCCC | 44.57 | 24489116 | |
| 49 | Ubiquitination | QGPAPAIKANTRLAR CCCCCHHHHCHHHHH | 37.38 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATPK_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATPK_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATPK_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATP7_YEAST | ATP7 | physical | 10747812 | |
| ATP18_YEAST | ATP18 | physical | 10747812 | |
| DNM1_YEAST | DNM1 | genetic | 18445678 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...