| UniProt ID | TFC1_YEAST | |
|---|---|---|
| UniProt AC | P32367 | |
| Protein Name | Transcription factor tau 95 kDa subunit | |
| Gene Name | TFC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 649 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | TFIIIC mediates tRNA and 5S RNA gene activation by binding to intragenic promoter elements. Upstream of the transcription start site, TFIIIC assembles the initiation complex TFIIIB-TFIIIC-tDNA, which is sufficient for RNA polymerase III recruitment and function. Part of the tauA domain of TFIIIC that binds boxA DNA promoter sites of tRNA and similar genes. Participates in the interconnection of tauA with tauB via its contacts with TFC3 and TFC6. Serves as a scaffold critical for tauA-DNA spatial configuration and tauB-DNA stability.. | |
| Protein Sequence | MPVEEPLATLSSIPDSSADQAPPLIADEFTLDLPRIPSLELPLNVSTKHSSIQKAIKMCGGIEKVKEAFKEHGPIESQHGLQLYLNDDTDSDGSKSYFNEHPVIGKRVPFRDESVILKVTMPKGTLSKNNNSVKDSIKSLKDSNKLRVTPVSIVDNTIKFREMSDFQIKLDNVPSAREFKSSFGSLEWNNFKSFVNSVPDNDSQPQENIGNLILDRSVKIPSTDFQLPPPPKLSMVGFPLLYKYKANPFAKKKKNGVTEVKGTYIKNYQLFVHDLSDKTVIPSQAHEQVLYDFEVAKKTKVYPGTKSDSKFYESLEECLKILRELFARRPIWVKRHLDGIVPKKIHHTMKIALALISYRFTMGPWRNTYIKFGIDPRSSVEYAQYQTEYFKIERKLLSSPIVKKNVPKPPPLVFESDTPGGIDSRFKFDGKRIPWYLMLQIDLLIGEPNIAEVFHNVEYLDKANELTGWFKELDLVKIRRIVKYELGCMVQGNYEYNKYKLKYFKTMLFVKESMVPENKNSEEGMGVNTNKDADGDINMDAGSQMSSNAIEEDKGIAAGDDFDDNGAITEEPDDAALENEEMDTDQNLKVPASIDDDVDDVDADEEEQESFDVKTASFQDIINKIAKLDPKTAETMKSELKGFVDEVDL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | YLNDDTDSDGSKSYF EECCCCCCCCCCCCC | 46.06 | 20377248 | |
| 399 | Phosphorylation | IERKLLSSPIVKKNV HHHHHHCCCCCCCCC | 20.72 | 19779198 | |
| 416 | Phosphorylation | PPPLVFESDTPGGID CCCEEEECCCCCCCC | 35.01 | 29688323 | |
| 418 | Phosphorylation | PLVFESDTPGGIDSR CEEEECCCCCCCCCC | 32.86 | 29688323 | |
| 424 | Phosphorylation | DTPGGIDSRFKFDGK CCCCCCCCCCEECCE | 37.38 | 29688323 | |
| 521 | Phosphorylation | MVPENKNSEEGMGVN HCCCCCCCCCCCCCC | 38.34 | 19779198 | |
| 543 | Phosphorylation | DINMDAGSQMSSNAI CCCCCCCCCCCCCCC | 25.16 | 28889911 | |
| 569 | Phosphorylation | FDDNGAITEEPDDAA CCCCCCCCCCCCHHH | 33.49 | 28889911 | |
| 615 | Phosphorylation | QESFDVKTASFQDII HHCCCCCHHHHHHHH | 27.64 | 30377154 | |
| 617 | Phosphorylation | SFDVKTASFQDIINK CCCCCHHHHHHHHHH | 28.77 | 27214570 | |
| 638 | Phosphorylation | KTAETMKSELKGFVD HHHHHHHHHHCCCCC | 37.02 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TFC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TFC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TFC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-617, AND MASSSPECTROMETRY. | |
