| UniProt ID | YEW7_YEAST | |
|---|---|---|
| UniProt AC | P40083 | |
| Protein Name | Uncharacterized protein YEL137C | |
| Gene Name | YER137C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 148 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MCESSNKTENDIVRLSQAMDVLAKLIISKQKDGSQLQVEYEHKLKELEKFINLLLGLHESTVGSMMNTSVLDMVLRNGIEIMEKDDQKYALIPIKAKEEADKTTSTIQGVTSKKSSKKKKNKIKCSFCHEAGHTRAHCGARLTVIPKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 103 | Phosphorylation | AKEEADKTTSTIQGV EHHHHCCCCCCHHHH | 26.90 | 27017623 | |
| 104 | Phosphorylation | KEEADKTTSTIQGVT HHHHCCCCCCHHHHC | 29.61 | 27017623 | |
| 105 | Phosphorylation | EEADKTTSTIQGVTS HHHCCCCCCHHHHCC | 28.83 | 28889911 | |
| 112 | Phosphorylation | STIQGVTSKKSSKKK CCHHHHCCCCCCCCC | 35.36 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YEW7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YEW7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YEW7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CSN12_YEAST | YJR084W | genetic | 27708008 | |
| SAC1_YEAST | SAC1 | genetic | 27708008 | |
| RL21B_YEAST | RPL21B | genetic | 27708008 | |
| NCBP2_YEAST | CBC2 | genetic | 27708008 | |
| YCZ2_YEAST | YCR102C | genetic | 27708008 | |
| SLX5_YEAST | SLX5 | genetic | 27708008 | |
| STL1_YEAST | STL1 | genetic | 27708008 | |
| RS27B_YEAST | RPS27B | genetic | 27708008 | |
| RL14A_YEAST | RPL14A | genetic | 27708008 | |
| MKS1_YEAST | MKS1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...