YCA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YCA2_YEAST
• UniProt AC: P25565
• Protein Name: Putative uncharacterized protein YCL002C
• Gene Name: YCL002C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 263
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MLVIVLQGLAGFLSIIAILCQKRYNKLHRSIYGLSYDLFLLDFVGNGLYLYCALHYCYSSLVREQLSQRFPLFYPLNDARSIPISSFLILKDFCVSCCCMMVLRQLYYYRSTKHIYQGISITSIIIISVFLVLGIFTYGCSISNLPLKNSGKFGVFYLEHINYLWVMANLLKCFKYVPQMSINWMGCSTVGLSSKFALISFLAESIDLLGRLVIPTNALFYEIPFNSTPFWVKLIQFVTLLVILCQVQYVYVGRKPRLPKGKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YCA2_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YCA2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YCA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YCA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
INO4_YEAST	INO4	genetic	27708008
PYC2_YEAST	PYC2	genetic	27708008
THIK_YEAST	POT1	genetic	27708008
DAL81_YEAST	DAL81	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.