| UniProt ID | PRP24_YEAST | |
|---|---|---|
| UniProt AC | P49960 | |
| Protein Name | U4/U6 snRNA-associated-splicing factor PRP24 | |
| Gene Name | PRP24 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 444 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Binds preferentially to the U4/U6 hybrid snRNAs. Can stimulate the annealing of U4 and U6. Could participate in both the formation and disassembly of the U4/U6 hybrid during splicing.. | |
| Protein Sequence | MEYGHHARPDSKRPLDEGSPAAAGLTSKKANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKKNFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQMNRSLLGNREISVSLADKKPFLERNEVKRLLASRNSKELETLICLFPLSDKVSPSLICQFLQEEIHINEKDIRKILLVSDFNGAIIIFRDSKFAAKMLMILNGSQFQGKVIRSGTINDMKRYYNNQQNHSMKHVKPSCINMMEKGPNLQVKKKIPDKQEQMSNDDFRKMFLGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MEYGHHARPD -----CCCCCCCCCC | 22.06 | 24961812 | |
| 11 | Phosphorylation | GHHARPDSKRPLDEG CCCCCCCCCCCCCCC | 32.99 | 24961812 | |
| 19 | Phosphorylation | KRPLDEGSPAAAGLT CCCCCCCCCCCCCCC | 14.87 | 22369663 | |
| 218 | Phosphorylation | EIMIRNLSTELLDEN HHHHHHCCHHHCCHH | 24.31 | 27214570 | |
| 219 | Phosphorylation | IMIRNLSTELLDENL HHHHHCCHHHCCHHH | 33.54 | 27214570 | |
| 403 | Acetylation | NQQNHSMKHVKPSCI CCCCCCCCCCCHHHH | 48.54 | 22865919 | |
| 408 | Phosphorylation | SMKHVKPSCINMMEK CCCCCCHHHHHHHCC | 23.16 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRP24_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP24_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19, AND MASSSPECTROMETRY. | |
