| UniProt ID | BET1_YEAST | |
|---|---|---|
| UniProt AC | P22804 | |
| Protein Name | Protein transport protein BET1 | |
| Gene Name | BET1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 142 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type IV membrane protein . Endoplasmic reticulum membrane Single-pass type IV membrane protein . |
|
| Protein Description | SNARE required for targeting and fusion of ER-derived transport vesicles with the Golgi complex.. | |
| Protein Sequence | MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEEQMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGISIKTWLIIFFMVGVLFFWVWIT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Phosphorylation | SLDDNVSSALGSTDK CCCCCHHHHCCCCCC | 24.19 | 28889911 | |
| 40 | Phosphorylation | NVSSALGSTDKLDYS CHHHHCCCCCCCCCC | 33.99 | 22369663 | |
| 41 | Phosphorylation | VSSALGSTDKLDYSQ HHHHCCCCCCCCCCH | 35.04 | 22369663 | |
| 58 | Phosphorylation | LASLESQSEEQMGAM HHHHHCCCHHHHHHH | 52.99 | 28889911 | |
| 76 | Phosphorylation | IKALKSLSLKMGDEI HHHHHHHCCCCCCCC | 32.79 | 28889911 | |
| 78 | Acetylation | ALKSLSLKMGDEIRG HHHHHCCCCCCCCCC | 37.14 | 24489116 | |
| 86 | Phosphorylation | MGDEIRGSNQTIDQL CCCCCCCCCCCHHHH | 18.86 | 28889911 | |
| 103 | Acetylation | TFHNTSVKLKRTFGN HCCCCCHHHHHHHHH | 48.32 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BET1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BET1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BET1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
