dbPTM

UGA4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UGA4_YEAST
UniProt AC	P32837
Protein Name	GABA-specific permease
Gene Name	UGA4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	571
Subcellular Localization	Vacuole membrane Multi-pass membrane protein .
Protein Description	Required for high-affinity, high-specificity GABA transport. Also transports putrescine..
Protein Sequence	MSMSSKNENKISVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFVAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGAIARLQTLSIFANLFIIVLLFIALPIGTKHRMGGFNDGDFIFGKYENLSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVFRLTSGRDLFRPGPFYLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNYACVIGPGIWILAGIYYKVYKKKYYHGPATNLSDDDYTEAVGADVIDTIMSKQEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	SKNENKISVEQRIST CCCCCCCCHHHHHCC	22.63	24961812
18	Phosphorylation	ISVEQRISTDIGQAY CCHHHHHCCCHHHHH	23.40	24961812
19	Phosphorylation	SVEQRISTDIGQAYQ CHHHHHCCCHHHHHH	29.30	24961812
25	Phosphorylation	STDIGQAYQLQGLGS CCCHHHHHHHCCCCC	11.23	24961812
32	Phosphorylation	YQLQGLGSNLRSIRS HHHCCCCCCHHHHHH	37.42	24961812
36	Phosphorylation	GLGSNLRSIRSKTGA CCCCCHHHHHHCCCC	26.06	24961812
39	Phosphorylation	SNLRSIRSKTGAGEV CCHHHHHHCCCCCCC	32.66	24961812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UGA4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UGA4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UGA4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YPT6_YEAST	YPT6	genetic	19061648
AIR2_YEAST	AIR2	genetic	19061648
PUS7_YEAST	PUS7	genetic	19061648
LSM7_YEAST	LSM7	genetic	19061648
UTP9_YEAST	UTP9	genetic	19061648
UAF30_YEAST	UAF30	genetic	19061648
MLP2_YEAST	MLP2	genetic	19061648
MKAR_YEAST	IFA38	physical	16093310
GLU2A_YEAST	ROT2	physical	16093310
SHR3_YEAST	SHR3	physical	16093310
YET1_YEAST	YET1	physical	16093310
GSF2_YEAST	GSF2	physical	16093310
PRM1_YEAST	PRM1	physical	16093310
HMDH1_YEAST	HMG1	genetic	21623372
COX6_YEAST	COX6	genetic	21623372
ARO1_YEAST	ARO1	genetic	21623372
ASK10_YEAST	ASK10	genetic	27708008
REI1_YEAST	REI1	genetic	27708008
YCY0_YEAST	YCR090C	genetic	27708008
RIM15_YEAST	RIM15	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
ATC1_YEAST	PMR1	genetic	27708008
RPN10_YEAST	RPN10	genetic	27708008
MNS1_YEAST	MNS1	genetic	27708008
DAN1_YEAST	DAN1	genetic	27708008
VPS24_YEAST	VPS24	genetic	27708008
UBR2_YEAST	UBR2	genetic	27708008
YPK2_YEAST	YPK2	genetic	27708008
LEU1_YEAST	LEU4	genetic	27708008
ZEO1_YEAST	ZEO1	genetic	27708008
YO114_YEAST	YOL114C	genetic	27708008
DNLI4_YEAST	DNL4	genetic	27708008
TGS1_YEAST	TGS1	genetic	27708008
VPS4_YEAST	VPS4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UGA4_YEAST

Related Literatures of Post-Translational Modification