| UniProt ID | CWC21_YEAST | |
|---|---|---|
| UniProt AC | Q03375 | |
| Protein Name | Pre-mRNA-splicing factor CWC21 | |
| Gene Name | CWC21 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 135 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Involved in pre-mRNA splicing. May function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome, together with ISY1. May do so by stabilizing the catalytic center or the position of the RNA substrate.. | |
| Protein Sequence | MSYNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASHDKASRPLAVQKQIETHMEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNEWQEQQRMSSLYTPRKARLTEEQHRHE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Acetylation | SYNGIGLKSAKGSST CCCCCCCCCCCCCCC | 43.06 | 25381059 | |
| 9 | Succinylation | SYNGIGLKSAKGSST CCCCCCCCCCCCCCC | 43.06 | 23954790 | |
| 12 | Acetylation | GIGLKSAKGSSTSGH CCCCCCCCCCCCHHH | 67.43 | 25381059 | |
| 15 | Phosphorylation | LKSAKGSSTSGHVQR CCCCCCCCCHHHHHH | 34.95 | 28889911 | |
| 62 | Acetylation | SRPLAVQKQIETHME HCCHHHHHHHHHHHH | 46.79 | 25381059 | |
| 97 | Acetylation | LSEEQIDKKCEALRA CCHHHHHHHHHHHHH | 62.04 | 24489116 | |
| 117 | Phosphorylation | WQEQQRMSSLYTPRK HHHHHHHHHCCCHHH | 21.27 | 24961812 | |
| 118 | Phosphorylation | QEQQRMSSLYTPRKA HHHHHHHHCCCHHHH | 18.95 | 24961812 | |
| 121 | Phosphorylation | QRMSSLYTPRKARLT HHHHHCCCHHHHCCC | 23.16 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC21_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC21_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC21_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
