UniProt ID | RS10B_YEAST | |
---|---|---|
UniProt AC | P46784 | |
Protein Name | 40S ribosomal protein S10-B {ECO:0000303|PubMed:9559554} | |
Gene Name | RPS10B {ECO:0000303|PubMed:9559554} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 105 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. [PubMed: 22096102 eS10 plays a role as a positive regulator of the GCN2 kinase activity by stimulating GCN1-mediated GCN2 activation] | |
Protein Sequence | MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPSQRPQRRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MLMPKQERNKIH ---CCCCHHHHHHHH | 51.32 | 23749301 | |
10 | Ubiquitination | MPKQERNKIHQYLFQ CCHHHHHHHHHHHHH | 48.03 | 23749301 | |
10 | Acetylation | MPKQERNKIHQYLFQ CCHHHHHHHHHHHHH | 48.03 | 24489116 | |
24 | 2-Hydroxyisobutyrylation | QEGVVVAKKDFNQAK HCCCEEEECCHHHHH | 41.06 | - | |
24 | Ubiquitination | QEGVVVAKKDFNQAK HCCCEEEECCHHHHH | 41.06 | 23749301 | |
25 | Ubiquitination | EGVVVAKKDFNQAKH CCCEEEECCHHHHHH | 58.79 | 23749301 | |
31 | Succinylation | KKDFNQAKHEEIDTK ECCHHHHHHHHCCCC | 41.61 | 23954790 | |
31 | Acetylation | KKDFNQAKHEEIDTK ECCHHHHHHHHCCCC | 41.61 | 24489116 | |
31 | Ubiquitination | KKDFNQAKHEEIDTK ECCHHHHHHHHCCCC | 41.61 | 23749301 | |
37 | Phosphorylation | AKHEEIDTKNLYVIK HHHHHCCCCHHHHHH | 27.74 | 28889911 | |
38 | Succinylation | KHEEIDTKNLYVIKA HHHHCCCCHHHHHHH | 41.00 | 23954790 | |
38 | Ubiquitination | KHEEIDTKNLYVIKA HHHHCCCCHHHHHHH | 41.00 | 23749301 | |
38 | Acetylation | KHEEIDTKNLYVIKA HHHHCCCCHHHHHHH | 41.00 | 24489116 | |
38 | 2-Hydroxyisobutyrylation | KHEEIDTKNLYVIKA HHHHCCCCHHHHHHH | 41.00 | - | |
44 | Ubiquitination | TKNLYVIKALQSLTS CCHHHHHHHHHHHCC | 32.76 | 23749301 | |
44 | Acetylation | TKNLYVIKALQSLTS CCHHHHHHHHHHHCC | 32.76 | 24489116 | |
48 | Phosphorylation | YVIKALQSLTSKGYV HHHHHHHHHCCCCCE | 34.17 | 22369663 | |
50 | Phosphorylation | IKALQSLTSKGYVKT HHHHHHHCCCCCEEE | 33.37 | 22369663 | |
51 | Phosphorylation | KALQSLTSKGYVKTQ HHHHHHCCCCCEEEE | 29.40 | 22369663 | |
52 | Succinylation | ALQSLTSKGYVKTQF HHHHHCCCCCEEEEE | 49.37 | 23954790 | |
52 | 2-Hydroxyisobutyrylation | ALQSLTSKGYVKTQF HHHHHCCCCCEEEEE | 49.37 | - | |
52 | Acetylation | ALQSLTSKGYVKTQF HHHHHCCCCCEEEEE | 49.37 | 24489116 | |
52 | Ubiquitination | ALQSLTSKGYVKTQF HHHHHCCCCCEEEEE | 49.37 | 23749301 | |
56 | Ubiquitination | LTSKGYVKTQFSWQY HCCCCCEEEEEEEEE | 28.29 | 22817900 | |
98 | Phosphorylation | YIQERNPSQRPQRRY CCCCCCCCCCCCCCC | 42.23 | 24909858 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS10B_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS10B_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS10B_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-48, AND MASSSPECTROMETRY. | |
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-48, AND MASSSPECTROMETRY. |